| Clone Name | rbaet65c04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RDRP_MRNV (Q6XNL5) RNA-directed RNA polymerase (EC 2.7.7.48) (Rd... | 31 | 1.0 | 2 | PPZ1_YEAST (P26570) Serine/threonine-protein phosphatase PP-Z1 (... | 28 | 6.6 | 3 | MADCA_HUMAN (Q13477) Mucosal addressin cell adhesion molecule 1 ... | 28 | 6.6 | 4 | AGI_URTDI (P11218) Lectin/endochitinase precursor (EC 3.2.1.14) ... | 28 | 6.6 |
|---|
>RDRP_MRNV (Q6XNL5) RNA-directed RNA polymerase (EC 2.7.7.48) (RdRp) (RNA| replicase) Length = 1045 Score = 30.8 bits (68), Expect = 1.0 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -2 Query: 192 SRSQVRWAAEDEGLWCRSVWAWCRS**DHGEMEPLLYLRN 73 S +QV + + G W VW WC D+GE LYL+N Sbjct: 217 SDNQVDYRVDGGGRWQHKVWNWC----DYGE---FLYLKN 249
>PPZ1_YEAST (P26570) Serine/threonine-protein phosphatase PP-Z1 (EC 3.1.3.16)| Length = 691 Score = 28.1 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +2 Query: 125 HQAHTDRHHRPSSSAAH 175 H +HT+R+H PSSS +H Sbjct: 79 HSSHTNRYHFPSSSHSH 95
>MADCA_HUMAN (Q13477) Mucosal addressin cell adhesion molecule 1 precursor| (MAdCAM-1) (hMAdCAM-1) Length = 406 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 66 GFSFLNTREVPFLHDPISSYTKPTQIDTTGPHPP 167 G + + +P LH P T P DTT P PP Sbjct: 212 GLELSHRQAIPVLHSP----TSPEPPDTTSPEPP 241
>AGI_URTDI (P11218) Lectin/endochitinase precursor (EC 3.2.1.14) (Agglutinin)| (UDA) Length = 372 Score = 28.1 bits (61), Expect = 6.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 153 LWCRSVWAWCRS**DHGEMEP 91 LWC S+W WC G+ EP Sbjct: 38 LWCCSIWGWC------GDSEP 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,834,054 Number of Sequences: 219361 Number of extensions: 650995 Number of successful extensions: 1808 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1808 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)