| Clone Name | rbaet65b06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CYAA_YEAST (P08678) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophos... | 32 | 0.56 | 2 | PPCK_CHLMU (Q9PLL6) Phosphoenolpyruvate carboxykinase [GTP] (EC ... | 28 | 4.8 |
|---|
>CYAA_YEAST (P08678) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 2026 Score = 31.6 bits (70), Expect = 0.56 Identities = 19/73 (26%), Positives = 35/73 (47%) Frame = +3 Query: 12 NNLSNQIILTSPARIRKAKQSITT*TSRHDMHHQAANKHIKA*RRTRARASGELHENMHD 191 + LSN + P+ +R+ S+ +S HD+++ A+K I R +A + +H Sbjct: 215 STLSNHLADNVPSTLRRKVSSLVRGSSVHDINNGIADKQI------RPKAVAQSENTLHS 268 Query: 192 DTCMDGLFSHRRS 230 + SHR+S Sbjct: 269 SDVPNSKRSHRKS 281
>PPCK_CHLMU (Q9PLL6) Phosphoenolpyruvate carboxykinase [GTP] (EC 4.1.1.32) (PEP| carboxykinase) (Phosphoenolpyruvate carboxylase) (PEPCK) Length = 599 Score = 28.5 bits (62), Expect = 4.8 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 217 LNNPSMHVSSCMFSCSSPDARARVLRYAFMC 125 L NP +H +C SSPD ARV ++ F+C Sbjct: 55 LLNPELH-PNCFLVRSSPDDVARVEQFTFIC 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,261,519 Number of Sequences: 219361 Number of extensions: 622245 Number of successful extensions: 1448 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1448 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)