ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet65a09 |
|---|---|
| Clone Library Name | barley_pub |
>GCH1_THETN (Q8R7N2) GTP cyclohydrolase I (EC 3.5.4.16) (GTP-CH-I)| Length = 188 Score = 33.5 bits (75), Expect = 0.15 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +1 Query: 91 PDLQGIHQLQKKLLRYYESKFSIIKNEVRYPKDISQDSENQTMILVSGTP 240 PD +G+ + ++ R YE FS + +V+ I Q+ E+Q +ILV P Sbjct: 22 PDREGLLETPDRVARMYEEIFSGLHTDVKDVIKIFQEDEHQEIILVKDIP 71
>CYB_EULMM (O99797) Cytochrome b| Length = 379 Score = 30.8 bits (68), Expect = 0.94 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +TG WN ++L FT+ +T F GY Sbjct: 109 LTGTWNIGIILLFTVMATAFMGY 131
>RS7_NEUCR (O43105) 40S ribosomal protein S7| Length = 202 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +1 Query: 91 PDLQGIHQLQKKLLRYYESKFS 156 P LQG H++Q++L R E KFS Sbjct: 71 PSLQGFHRVQQRLTRELEKKFS 92
>MELK_HUMAN (Q14680) Maternal embryonic leucine zipper kinase (EC 2.7.11.1)| (hMELK) (Protein kinase PK38) (hPK38) Length = 651 Score = 28.5 bits (62), Expect = 4.7 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 43 QDHGTKTCCSNLRYAAPDL 99 +D+ +TCC +L YAAP+L Sbjct: 161 KDYHLQTCCGSLAYAAPEL 179
>CYB_ZALCA (Q36266) Cytochrome b| Length = 379 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S +T WN ++L FTI +T F GY Sbjct: 106 SYTLTETWNIGIILLFTIMATAFMGY 131
>CYB_EUMJU (Q34471) Cytochrome b| Length = 379 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S +T WN ++L FTI +T F GY Sbjct: 106 SYTLTETWNIGIILLFTIMATAFMGY 131
>CYB_EULMF (O99798) Cytochrome b| Length = 379 Score = 28.5 bits (62), Expect = 4.7 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNMGIILLFTVMATAFMGY 131
>CYB_ARCGZ (Q33688) Cytochrome b| Length = 379 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S +T WN ++L FTI +T F GY Sbjct: 106 SYTLTETWNIGIILLFTIMATAFMGY 131
>MELK_MOUSE (Q61846) Maternal embryonic leucine zipper kinase (EC 2.7.11.1)| (Protein kinase PK38) (mPK38) Length = 643 Score = 28.5 bits (62), Expect = 4.7 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 43 QDHGTKTCCSNLRYAAPDL 99 +D+ +TCC +L YAAP+L Sbjct: 161 KDYHLQTCCGSLAYAAPEL 179
>TMCC3_MOUSE (Q8R310) Transmembrane and coiled-coil domains protein 3| Length = 446 Score = 28.5 bits (62), Expect = 4.7 Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +1 Query: 106 IHQLQKKLLRYYESKFSIIKNEV-RYPKDISQDS 204 I QLQKKL +Y+ I +N V R KDIS+DS Sbjct: 95 IAQLQKKLEQYHRKLREIEQNGVTRSSKDISKDS 128
>CYB_HYSAF (Q04910) Cytochrome b| Length = 384 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN +LL FT+ +T F GY Sbjct: 106 SYMFTETWNIGILLLFTVMATAFMGY 131
>FAIM2_HUMAN (Q9BWQ8) Fas apoptotic inhibitory molecule 2 (Lifeguard protein)| (Transmembrane BAX inhibitor motif-containing protein 2) Length = 316 Score = 27.7 bits (60), Expect = 8.0 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 48 PWNKNLLLQFTIRSTRFTGYSSTPKETTTVL 140 PWN LL FT+ TG S+ TT+VL Sbjct: 166 PWNLILLTVFTLSMAYLTGMLSSYYNTTSVL 196
>CYB_PROSA (Q6ELU8) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 42 TGPWNKNLLLQFTIRSTRFTGY 107 T WN +LL FT+ +T F GY Sbjct: 110 TETWNIGILLLFTVMATAFMGY 131
>CYB_OMMRO (Q678S8) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FTI +T F GY Sbjct: 106 SYTFTETWNIGIILLFTIMATAFMGY 131
>CYB_MIRLE (Q35019) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FTI +T F GY Sbjct: 106 SYTFTETWNIGIILLFTIMATAFMGY 131
>CYB_MICMU (Q9G0S9) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 8.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_LOBCR (Q678S9) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FTI +T F GY Sbjct: 106 SYTFTETWNIGIILLFTIMATAFMGY 131
>CYB_HALGR (P38593) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S T WN ++L FTI +T F GY Sbjct: 106 SYTFTETWNIGIILLFTIMATAFMGY 131
>CYB_GALEE (Q85PP0) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 30 SRKITGPWNKNLLLQFTIRSTRFTGY 107 S + WN +LL FT+ +T F GY Sbjct: 106 SHTFSETWNVGILLLFTVMATAFMGY 131
>CYB_EULRU (O99800) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 8.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_EULMO (O99799) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 8.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_EULFC (Q34459) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 8.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131
>CYB_EULCO (Q5VJ65) Cytochrome b| Length = 379 Score = 27.7 bits (60), Expect = 8.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 39 ITGPWNKNLLLQFTIRSTRFTGY 107 +T WN ++L FT+ +T F GY Sbjct: 109 LTETWNIGIILLFTVMATAFMGY 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,207,023 Number of Sequences: 219361 Number of extensions: 751493 Number of successful extensions: 3072 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 3037 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3072 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
