| Clone Name | rbaet65a02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CUTI_PHYCP (P41754) Putative cutinase (EC 3.1.1.74) (Cutin hydro... | 29 | 2.7 | 2 | PTPRK_HUMAN (Q15262) Receptor-type tyrosine-protein phosphatase ... | 28 | 5.9 | 3 | PTPRK_MOUSE (P35822) Receptor-type tyrosine-protein phosphatase ... | 28 | 5.9 | 4 | HST1_YEAST (P53685) NAD-dependent deacetylase HST1 (EC 3.5.1.-) ... | 28 | 7.8 |
|---|
>CUTI_PHYCP (P41754) Putative cutinase (EC 3.1.1.74) (Cutin hydrolase)| Length = 210 Score = 29.3 bits (64), Expect = 2.7 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = -1 Query: 185 MIPMYASSLSKIYGEVSSVDQFVTSLCFYLFPRFLCVYSSCKMLGSLCG-RIKPYYKTYP 9 M M++ +S + S Q S C L P F+ +YS+ +L +L + PY T P Sbjct: 108 MHDMFSPCISGVANSQHSSSQSPRSHCRSLVPSFIAIYSASVVLCALISCFLDPYETTLP 167 Query: 8 L 6 L Sbjct: 168 L 168
>PTPRK_HUMAN (Q15262) Receptor-type tyrosine-protein phosphatase kappa precursor| (EC 3.1.3.48) (Protein-tyrosine phosphatase kappa) (R-PTP-kappa) Length = 1439 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 71 STHTKIWEIGKNINSLQTGQRKILHHRSYSASLHTSE 181 + H K+W +N + Q K ++HR ++AS E Sbjct: 223 AVHNKLWLQRRNGEDIPVAQTKNINHRRFAASFRLQE 259
>PTPRK_MOUSE (P35822) Receptor-type tyrosine-protein phosphatase kappa precursor| (EC 3.1.3.48) (Protein-tyrosine phosphatase kappa) (R-PTP-kappa) Length = 1457 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +2 Query: 71 STHTKIWEIGKNINSLQTGQRKILHHRSYSASLHTSE 181 + H K+W +N + Q K ++HR ++AS E Sbjct: 222 AVHNKLWLQRRNGEDIPVAQTKNINHRRFAASFRLQE 258
>HST1_YEAST (P53685) NAD-dependent deacetylase HST1 (EC 3.5.1.-) (Homologous to| SIR2 protein 1) Length = 503 Score = 27.7 bits (60), Expect = 7.8 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 227 CHWDTSHRRREDLNMIPMYASSLSK 153 CHWD H++ +DL I + + K Sbjct: 465 CHWDIPHKKWQDLKKIDYNCTEIDK 489 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,716,381 Number of Sequences: 219361 Number of extensions: 819687 Number of successful extensions: 1739 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1739 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)