| Clone Name | rbaet64h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RS27_PYRAE (Q8ZTY4) 30S ribosomal protein S27e | 28 | 4.2 | 2 | MFNA_METTH (O27188) L-tyrosine decarboxylase (EC 4.1.1.25) (TDC) | 28 | 5.5 | 3 | GID_SYMTH (Q67PC6) tRNA uridine 5-carboxymethylaminomethyl modif... | 28 | 7.2 |
|---|
>RS27_PYRAE (Q8ZTY4) 30S ribosomal protein S27e| Length = 67 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 107 PVRVRSLLVPHTLSKFVPIICRDNNNSAPKESVHALVLR 223 PVR +L+P SKF+ C D N S A+V+R Sbjct: 2 PVRFSKVLIPQPKSKFIKTRCPDCGNEQITFSHAAMVVR 40
>MFNA_METTH (O27188) L-tyrosine decarboxylase (EC 4.1.1.25) (TDC)| Length = 363 Score = 28.1 bits (61), Expect = 5.5 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 101 SCPVRVRSLLVPHTLSKFVPIICRD 175 SCP +R +L+PH + + + ++ RD Sbjct: 330 SCPPAIRVVLMPHIMEEHIELLLRD 354
>GID_SYMTH (Q67PC6) tRNA uridine 5-carboxymethylaminomethyl modification| enzyme gid Length = 447 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -2 Query: 231 RPHRSTSAWTLSFGAELLLSRQIMGTNLDNV*GTSRDRTR 112 RPH +T+ AEL+ S + G L+N G ++ R Sbjct: 35 RPHVTTAVHRTGLFAELVCSNSLRGAGLENAVGLLKEEMR 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,773,148 Number of Sequences: 219361 Number of extensions: 688791 Number of successful extensions: 1259 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1259 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)