ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
Japanese | English
更新日:2016年5月1日

Clone Information

BLAST Search Result

Clone Name rbaet64g10
Clone Library Name barley_pub

No. Definition Score
(bits)
E
Value
1CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloropl... 32 0.43
2CB2F_LYCES (P14277) Chlorophyll a-b binding protein 3B, chloropl... 32 0.43
3CB2E_LYCES (P14276) Chlorophyll a-b binding protein 3A, chloropl... 32 0.43
4CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloropla... 32 0.43
5CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chl... 32 0.43
6CB2C_LYCES (P14275) Chlorophyll a-b binding protein 1C, chloropl... 32 0.43
7CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloropl... 32 0.43
8CB2A_LYCES (P14274) Chlorophyll a-b binding protein 1A, chloropl... 32 0.43
9CB26_PETSP (P12062) Chlorophyll a-b binding protein 37, chloropl... 32 0.43
10CB23_PEA (P27520) Chlorophyll a-b binding protein 215, chloropla... 32 0.43
11CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast... 32 0.43
12CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloropla... 32 0.43
13CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII typ... 32 0.43
14CB21_RAPSA (P14584) Chlorophyll a-b binding of LHCII type 1 prot... 32 0.43
15CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloropl... 32 0.43
16CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloropla... 32 0.43
17CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloropl... 32 0.43
18CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII typ... 31 0.74
19CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloropla... 31 0.74
20CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloropla... 31 0.96
21CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII typ... 31 0.96
22CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloropla... 31 0.96
23CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloropla... 31 0.96
24CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloropl... 31 0.96
25CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloropla... 31 0.96
26CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloropl... 31 0.96
27CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloropla... 31 0.96
28CB23_TOBAC (P27494) Chlorophyll a-b binding protein 36, chloropl... 31 0.96
29CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 membe... 31 0.96
30CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloropl... 31 0.96
31CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast... 31 0.96
32CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloropla... 31 0.96
33CB21_GOSHI (P27518) Chlorophyll a-b binding protein 151, chlorop... 31 0.96
34CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloropl... 31 0.96
35CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 membe... 31 0.96
36CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast... 31 0.96
37CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII typ... 31 0.96
38CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloropla... 31 0.96
39CB23_ORYSA (P27519) Chlorophyll a-b binding protein, chloroplast... 31 0.96
40CB21_PINTH (P10049) Chlorophyll a-b binding protein type I, chlo... 31 0.96
41SYFA_TROW8 (Q83HH3) Phenylalanyl-tRNA synthetase alpha chain (EC... 31 0.96
42CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloropl... 31 0.96
43CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 membe... 31 0.96
44CB22_PINSY (P15192) Chlorophyll a-b binding protein type 2 membe... 31 0.96
45CB2D_LYCES (P10707) Chlorophyll a-b binding protein 1D (LHCII ty... 30 2.1
46CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast... 30 2.1
47CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast... 30 2.1
48CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloropl... 30 2.1
49CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chlorop... 30 2.1
50CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chlorop... 30 2.1
51CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloropla... 30 2.1
52CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloropl... 30 2.1
53CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloropl... 30 2.1
54CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII ty... 30 2.1
55UVRA_CHLTR (O84337) UvrABC system protein A (UvrA protein) (Exci... 29 3.7
56PYRB_BIFLO (Q8G655) Aspartate carbamoyltransferase (EC 2.1.3.2) ... 29 3.7
57UVRA_CHLPN (Q9Z985) UvrABC system protein A (UvrA protein) (Exci... 28 4.8
58CAC1C_RABIT (P15381) Voltage-dependent L-type calcium channel al... 28 6.2
59SYFA_TROWT (Q83GS9) Phenylalanyl-tRNA synthetase alpha chain (EC... 28 6.2
60RECN_XYLFT (Q87BS5) DNA repair protein recN (Recombination prote... 28 8.2
61CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast... 28 8.2

>CB2G_LYCES (P07369) Chlorophyll a-b binding protein 3C, chloroplast precursor|
           (LHCII type I CAB-3C) (LHCP)
          Length = 267

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 254 NNAWAFATNFVPG 266



to top

>CB2F_LYCES (P14277) Chlorophyll a-b binding protein 3B, chloroplast precursor|
           (LHCII type I CAB-3B) (LHCP) (Fragments)
          Length = 267

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 254 NNAWAFATNFVPG 266



to top

>CB2E_LYCES (P14276) Chlorophyll a-b binding protein 3A, chloroplast precursor|
           (LHCII type I CAB-3A) (LHCP) (Fragments)
          Length = 267

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 254 NNAWAFATNFVPG 266



to top

>CB22_ARATH (P04778) Chlorophyll a-b binding protein 2, chloroplast precursor|
           (LHCII type I CAB-2) (CAB-140) (LHCP)
          Length = 267

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 254 NNAWAFATNFVPG 266



to top

>CB21_ARATH (P04777) Chlorophyll a-b binding protein 165/180, chloroplast|
           precursor (LHCII type I CAB-165/180)
          Length = 267

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 254 NNAWAFATNFVPG 266



to top

>CB2C_LYCES (P14275) Chlorophyll a-b binding protein 1C, chloroplast precursor|
           (LHCII type I CAB-1C) (LHCP) (Fragments)
          Length = 265

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 252 NNAWAFATNFVPG 264



to top

>CB2B_LYCES (P07370) Chlorophyll a-b binding protein 1B, chloroplast precursor|
           (LHCII type I CAB-1B) (LHCP)
          Length = 265

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 252 NNAWAFATNFVPG 264



to top

>CB2A_LYCES (P14274) Chlorophyll a-b binding protein 1A, chloroplast precursor|
           (LHCII type I CAB-1A) (LHCP) (Fragments)
          Length = 265

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 252 NNAWAFATNFVPG 264



to top

>CB26_PETSP (P12062) Chlorophyll a-b binding protein 37, chloroplast precursor|
           (LHCII type I CAB-37) (LHCP)
          Length = 265

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 252 NNAWAFATNFVPG 264



to top

>CB23_PEA (P27520) Chlorophyll a-b binding protein 215, chloroplast precursor|
           (LHCII type II CAB-215) (LHCP)
          Length = 265

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 252 NNAWAFATNFVPG 264



to top

>CB23_APIGR (P92919) Chlorophyll a-b binding protein, chloroplast precursor|
           (Allergen Api g 3)
          Length = 264

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 251 NNAWAFATNFVPG 263



to top

>CB22_HORVU (P08963) Chlorophyll a-b binding protein 2, chloroplast precursor|
           (LHCII type I CAB-2) (LHCP)
          Length = 264

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 251 NNAWAFATNFVPG 263



to top

>CB21_LEMGI (P12328) Chlorophyll a-b binding protein of LHCII type I,|
           chloroplast precursor (CAB) (LHCP)
          Length = 264

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 251 NNAWAFATNFVPG 263



to top

>CB21_RAPSA (P14584) Chlorophyll a-b binding of LHCII type 1 protein|
           (Chlorophyll a-b binding of LHCII type I protein) (CAB)
           (LHCP) (Fragment)
          Length = 124

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 111 NNAWAFATNFVPG 123



to top

>CB24_PETSP (P04782) Chlorophyll a-b binding protein 25, chloroplast precursor|
           (LHCII type I CAB-25) (LHCP)
          Length = 266

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 253 NNAWAFATNFVPG 265



to top

>CB21_SINAL (P13851) Chlorophyll a-b binding protein 1, chloroplast precursor|
           (LHCII type I CAB-1) (LHCP)
          Length = 266

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 253 NNAWAFATNFVPG 265



to top

>CB21_PETSP (P04779) Chlorophyll a-b binding protein 13, chloroplast precursor|
           (LHCII type I CAB-13) (LHCP)
          Length = 266

 Score = 32.0 bits (71), Expect = 0.43
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWAFATNF PG
Sbjct: 253 NNAWAFATNFVPG 265



to top

>CB23_HORVU (P27523) Chlorophyll a-b binding protein of LHCII type III,|
           chloroplast precursor (CAB)
          Length = 268

 Score = 31.2 bits (69), Expect = 0.74
 Identities = 12/14 (85%), Positives = 12/14 (85%)
 Frame = -1

Query: 253 NNAWAFATNFAPGS 212
           NNAW FAT FAPGS
Sbjct: 255 NNAWVFATKFAPGS 268



to top

>CB21_MAIZE (P12329) Chlorophyll a-b binding protein 1, chloroplast precursor|
           (LHCII type I CAB-1) (LHCP)
          Length = 262

 Score = 31.2 bits (69), Expect = 0.74
 Identities = 11/14 (78%), Positives = 13/14 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPGS 212
           NNAWA+ATNF PG+
Sbjct: 249 NNAWAYATNFVPGN 262



to top

>CB22_ORYSA (P12331) Chlorophyll a-b binding protein 2, chloroplast precursor|
           (LHCII type I CAB-2) (LHCP)
          Length = 261

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 248 NNAWAYATNFVPG 260



to top

>CB22_CUCSA (P08222) Chlorophyll a-b binding protein of LHCII type 1|
           (Chlorophyll a-b binding protein of LHCII type I) (CAB)
           (LHCP) (Fragment)
          Length = 206

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 193 NNAWAYATNFVPG 205



to top

>CB25_LYCES (P14279) Chlorophyll a-b binding protein 5, chloroplast precursor|
           (LHCII type I CAB-5) (LHCP) (Fragment)
          Length = 237

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 224 NNAWAYATNFVPG 236



to top

>CB27_TOBAC (P27491) Chlorophyll a-b binding protein 7, chloroplast precursor|
           (LHCII type I CAB-7) (LHCP)
          Length = 267

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 254 NNAWAYATNFVPG 266



to top

>CB24_TOBAC (P27495) Chlorophyll a-b binding protein 40, chloroplast precursor|
           (LHCII type I CAB-40) (LHCP)
          Length = 267

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 254 NNAWAYATNFVPG 266



to top

>CB23_NICPL (P12469) Chlorophyll a-b binding protein C, chloroplast precursor|
           (LHCII type I CAB-C) (LHCP)
          Length = 267

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 254 NNAWAYATNFVPG 266



to top

>CB29_MAIZE (P27497) Chlorophyll a-b binding protein M9, chloroplast precursor|
           (LHCII type I CAB-M9) (LHCP)
          Length = 265

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 252 NNAWAYATNFVPG 264



to top

>CB24_LYCES (P14278) Chlorophyll a-b binding protein 4, chloroplast precursor|
           (LHCII type I CAB-4) (LHCP)
          Length = 265

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 252 NNAWAYATNFVPG 264



to top

>CB23_TOBAC (P27494) Chlorophyll a-b binding protein 36, chloroplast precursor|
           (LHCII type I CAB-36) (LHCP)
          Length = 265

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 252 NNAWAYATNFVPG 264



to top

>CB23_POLMU (P15195) Chlorophyll a-b binding protein type 1 member F3,|
           chloroplast precursor (DE Chlorophyll a-b binding
           protein type I F3) (CAB-F3) (LHCP)
          Length = 265

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 252 NNAWAYATNFTPG 264



to top

>CB22_TOBAC (P27493) Chlorophyll a-b binding protein 21, chloroplast precursor|
           (LHCII type I CAB-21) (LHCP)
          Length = 265

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 252 NNAWAYATNFVPG 264



to top

>CB22_MAIZE (P06671) Chlorophyll a-b binding protein, chloroplast precursor|
           (LHCII type I CAB) (LHCP)
          Length = 265

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 252 NNAWAYATNFVPG 264



to top

>CB21_ORYSA (P12330) Chlorophyll a-b binding protein 1, chloroplast precursor|
           (LHCII type I CAB-1) (LHCP)
          Length = 265

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 252 NNAWAYATNFVPG 264



to top

>CB21_GOSHI (P27518) Chlorophyll a-b binding protein 151, chloroplast precursor|
           (LHCII type II CAB-151) (LHCP)
          Length = 265

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 252 NNAWAYATNFVPG 264



to top

>CB48_MAIZE (Q00827) Chlorophyll a-b binding protein 48, chloroplast precursor|
           (LHCII type I CAB-48) (LHCP)
          Length = 264

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 251 NNAWAYATNFVPG 263



to top

>CB2B_PINSY (P15194) Chlorophyll a-b binding protein type 2 member 1B,|
           chloroplast precursor (Chlorophyll a-b binding protein
           type II 1B) (CAB) (LHCP)
          Length = 274

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 261 NNAWAYATNFVPG 273



to top

>CB21_SOYBN (P12471) Chlorophyll a-b binding protein, chloroplast precursor|
           (LHCII type I CAB) (LHCP) (Fragment)
          Length = 245

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 232 NNAWAYATNFVPG 244



to top

>CB21_CUCSA (P08221) Chlorophyll a-b binding protein of LHCII type I,|
           chloroplast precursor (CAB) (LHCP) (Fragment)
          Length = 255

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 242 NNAWAYATNFVPG 254



to top

>CB23_SOYBN (P09756) Chlorophyll a-b binding protein 3, chloroplast precursor|
           (LHCII type I CAB-3) (LHCP)
          Length = 263

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 250 NNAWAYATNFVPG 262



to top

>CB23_ORYSA (P27519) Chlorophyll a-b binding protein, chloroplast precursor|
           (LHCII type I CAB) (LHCP)
          Length = 263

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 250 NNAWAYATNFVPG 262



to top

>CB21_PINTH (P10049) Chlorophyll a-b binding protein type I, chloroplast|
           precursor (CAB) (LHCP)
          Length = 266

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 253 NNAWAYATNFVPG 265



to top

>SYFA_TROW8 (Q83HH3) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)|
           (Phenylalanine--tRNA ligase alpha chain) (PheRS)
          Length = 336

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 3/64 (4%)
 Frame = +2

Query: 2   THNPSIHSLVHTLCSINLHCAQLGRG---HLARSMMMIQINTQSTCSYTLIHDVQVHMHI 172
           TH P  H L   +C  N+    L +G    LAR +   ++N +  C+Y    +      I
Sbjct: 208 THTPVFHQLEGLVCDRNITLGHL-KGTVEDLARYLFGAEVNLRMRCNYFPFTEPSAEFDI 266

Query: 173 SSDG 184
           S DG
Sbjct: 267 SRDG 270



to top

>CB2A_PYRPY (P24006) Chlorophyll a-b binding protein 1A, chloroplast precursor|
           (LHCII type II CAB-1A) (LHCP)
          Length = 278

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 265 NNAWAYATNFVPG 277



to top

>CB2A_PINSY (P15193) Chlorophyll a-b binding protein type 2 member 1A,|
           chloroplast precursor (Chlorophyll a-b binding protein
           type II 1A) (CAB) (LHCP)
          Length = 278

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 265 NNAWAYATNFVPG 277



to top

>CB22_PINSY (P15192) Chlorophyll a-b binding protein type 2 member 2|
           (Chlorophyll a-b binding protein type II 2) (CAB) (LHCP)
           (Fragment)
          Length = 150

 Score = 30.8 bits (68), Expect = 0.96
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAWA+ATNF PG
Sbjct: 137 NNAWAYATNFVPG 149



to top

>CB2D_LYCES (P10707) Chlorophyll a-b binding protein 1D (LHCII type I CAB-1D)|
           (LHCP) (Fragment)
          Length = 116

 Score = 29.6 bits (65), Expect = 2.1
 Identities = 10/13 (76%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAW++ATNF PG
Sbjct: 103 NNAWSYATNFVPG 115



to top

>CB2A_SPIOL (P12333) Chlorophyll a-b binding protein, chloroplast precursor|
           (LHCII type I CAB) (LHCP)
          Length = 267

 Score = 29.6 bits (65), Expect = 2.1
 Identities = 11/13 (84%), Positives = 11/13 (84%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAW FATNF PG
Sbjct: 254 NNAWNFATNFVPG 266



to top

>CB28_PEA (P27490) Chlorophyll a-b binding protein 8, chloroplast precursor|
           (LHCII type I CAB-8)
          Length = 268

 Score = 29.6 bits (65), Expect = 2.1
 Identities = 10/13 (76%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAW++ATNF PG
Sbjct: 255 NNAWSYATNFVPG 267



to top

>CB25_TOBAC (P27496) Chlorophyll a-b binding protein 50, chloroplast precursor|
           (LHCII type I CAB-50) (LHCP)
          Length = 267

 Score = 29.6 bits (65), Expect = 2.1
 Identities = 10/13 (76%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAW++ATNF PG
Sbjct: 254 NNAWSYATNFVPG 266



to top

>CB25_PETSP (P04783) Chlorophyll a-b binding protein 91R, chloroplast precursor|
           (LHCII type I CAB-91R) (LHCP)
          Length = 267

 Score = 29.6 bits (65), Expect = 2.1
 Identities = 10/13 (76%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAW++ATNF PG
Sbjct: 254 NNAWSYATNFVPG 266



to top

>CB23_PETSP (P04781) Chlorophyll a-b binding protein 22R, chloroplast precursor|
           (LHCII type I CAB-22R) (LHCP)
          Length = 267

 Score = 29.6 bits (65), Expect = 2.1
 Identities = 10/13 (76%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAW++ATNF PG
Sbjct: 254 NNAWSYATNFVPG 266



to top

>CB25_NICPL (P12470) Chlorophyll a-b binding protein E, chloroplast precursor|
           (LHCII type I CAB-E) (LHCP)
          Length = 266

 Score = 29.6 bits (65), Expect = 2.1
 Identities = 10/13 (76%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAW++ATNF PG
Sbjct: 253 NNAWSYATNFVPG 265



to top

>CB21_TOBAC (P27492) Chlorophyll a-b binding protein 16, chloroplast precursor|
           (LHCII type I CAB-16) (LHCP)
          Length = 266

 Score = 29.6 bits (65), Expect = 2.1
 Identities = 10/13 (76%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAW++ATNF PG
Sbjct: 253 NNAWSYATNFVPG 265



to top

>CB22_PEA (P07371) Chlorophyll a-b binding protein AB80, chloroplast|
           precursor (LHCII type I CAB-AB80) (LHCP)
          Length = 269

 Score = 29.6 bits (65), Expect = 2.1
 Identities = 10/13 (76%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAW++ATNF PG
Sbjct: 256 NNAWSYATNFVPG 268



to top

>CB21_PEA (P04159) Chlorophyll a-b binding protein AB96 (LHCII type I|
           CAB-AB96) (LHCP) (Major 15) (Fragment)
          Length = 228

 Score = 29.6 bits (65), Expect = 2.1
 Identities = 10/13 (76%), Positives = 12/13 (92%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAW++ATNF PG
Sbjct: 215 NNAWSYATNFVPG 227



to top

>UVRA_CHLTR (O84337) UvrABC system protein A (UvrA protein) (Excinuclease ABC|
           subunit A)
          Length = 1786

 Score = 28.9 bits (63), Expect = 3.7
 Identities = 22/66 (33%), Positives = 30/66 (45%)
 Frame = +2

Query: 11  PSIHSLVHTLCSINLHCAQLGRGHLARSMMMIQINTQSTCSYTLIHDVQVHMHISSDGQT 190
           PSIH  + TLC++ L    LGR   + S   IQ   +   +Y L+  V+       D  T
Sbjct: 780 PSIHQKIETLCTLGLQYLPLGRPLYSLSGGEIQ---RLKLAYELLAPVKHPTLYVLDEPT 836

Query: 191 DGC*TH 208
            G  TH
Sbjct: 837 TGLHTH 842



to top

>PYRB_BIFLO (Q8G655) Aspartate carbamoyltransferase (EC 2.1.3.2) (Aspartate|
           transcarbamylase) (ATCase)
          Length = 326

 Score = 28.9 bits (63), Expect = 3.7
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 2/53 (3%)
 Frame = +2

Query: 2   THNPSIHSLVHTLCSI-NLHCAQLGRGHLARSMMMI-QINTQSTCSYTLIHDV 154
           T   ++HSL+ TLC   N+    +    L     +I +IN   +CSY  + D+
Sbjct: 167 TFGRTVHSLIETLCRFGNVRFVLISPDELKTPQYVIDRINATDSCSYVEVRDL 219



to top

>UVRA_CHLPN (Q9Z985) UvrABC system protein A (UvrA protein) (Excinuclease ABC|
           subunit A)
          Length = 1826

 Score = 28.5 bits (62), Expect = 4.8
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = +2

Query: 8   NPSIHSLVHTLCSINLHCAQLGR 76
           +P IH  +H LCS+ L    LGR
Sbjct: 781 HPKIHEKIHALCSLRLDYLPLGR 803



to top

>CAC1C_RABIT (P15381) Voltage-dependent L-type calcium channel alpha-1C subunit|
           (Voltage-gated calcium channel alpha subunit Cav1.2)
           (Calcium channel, L type, alpha-1 polypeptide, isoform
           1, cardiac muscle) (Smooth muscle calcium channel
           blocker receptor)
          Length = 2171

 Score = 28.1 bits (61), Expect = 6.2
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +2

Query: 104 IQINTQSTCSYTLIHDVQV-HMHISSDGQTDG 196
           +   T+STC  T++H+ Q+ H +IS  G   G
Sbjct: 20  LSAETESTCKGTVVHEAQLNHFYISPGGSNYG 51



to top

>SYFA_TROWT (Q83GS9) Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)|
           (Phenylalanine--tRNA ligase alpha chain) (PheRS)
          Length = 336

 Score = 28.1 bits (61), Expect = 6.2
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 3/64 (4%)
 Frame = +2

Query: 2   THNPSIHSLVHTLCSINLHCAQLGRG---HLARSMMMIQINTQSTCSYTLIHDVQVHMHI 172
           TH P  H L   +C  N+    L +G    LA  +   ++N +  C+Y    +      I
Sbjct: 208 THTPVFHQLEGLVCDRNITLGHL-KGTVEDLAGYLFGAEVNLRMRCNYFPFTEPSAEFDI 266

Query: 173 SSDG 184
           S DG
Sbjct: 267 SRDG 270



to top

>RECN_XYLFT (Q87BS5) DNA repair protein recN (Recombination protein N)|
          Length = 557

 Score = 27.7 bits (60), Expect = 8.2
 Identities = 14/48 (29%), Positives = 24/48 (50%)
 Frame = +2

Query: 17  IHSLVHTLCSINLHCAQLGRGHLARSMMMIQINTQSTCSYTLIHDVQV 160
           +H+  HTL  +N H A+LG         MIQ++   T    + +D+ +
Sbjct: 245 LHAARHTLSRVNEHDARLGEVETLLDNAMIQVDEALTLLDRIHNDLNI 292



to top

>CB21_WHEAT (P04784) Chlorophyll a-b binding protein, chloroplast precursor|
           (LHCII type I CAB) (LHCP)
          Length = 266

 Score = 27.7 bits (60), Expect = 8.2
 Identities = 10/13 (76%), Positives = 10/13 (76%)
 Frame = -1

Query: 253 NNAWAFATNFAPG 215
           NNAW  ATNF PG
Sbjct: 253 NNAWLIATNFVPG 265


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 37,960,312
Number of Sequences: 219361
Number of extensions: 673735
Number of successful extensions: 2095
Number of sequences better than 10.0: 61
Number of HSP's better than 10.0 without gapping: 2071
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2092
length of database: 80,573,946
effective HSP length: 59
effective length of database: 67,631,647
effective search space used: 1623159528
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
to top