| Clone Name | rbaet64e03 |
|---|---|
| Clone Library Name | barley_pub |
>TRRAP_HUMAN (Q9Y4A5) Transformation/transcription domain-associated protein| (350/400 kDa PCAF-associated factor) (PAF350/400) (STAF40) (Tra1 homolog) Length = 3859 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = -2 Query: 250 WD*LDDYTARDGFLPPPRACYVIQCARTHPSSIANWRFVQHFLVLSKLSCPKLLLYNV 77 W+ L +Y G + P V++CA ++NW ++ LV ++SCPK + + V Sbjct: 2834 WEALTEYGQSKGHINP---YLVLECAWR----VSNWTAMKEALVQVEVSCPKEMAWKV 2884
>Y588_ARCFU (O29667) Hypothetical protein AF0588| Length = 481 Score = 29.3 bits (64), Expect = 2.5 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -2 Query: 172 RTHPSSIANWRFVQHFLVLSKLSCPKL 92 R HP+ +A WR V+H+ L + + PK+ Sbjct: 331 RAHPNMLAGWRQVKHYWELLEKADPKM 357
>TRRAP_MOUSE (Q80YV3) Transformation/transcription domain-associated protein (Tra1| homolog) Length = 2565 Score = 28.5 bits (62), Expect = 4.3 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = -2 Query: 250 WD*LDDYTARDGFLPPPRACYVIQCARTHPSSIANWRFVQHFLVLSKLSCPKLLLYNV 77 W+ L ++ G + P V++CA ++NW ++ LV ++SCPK + + V Sbjct: 1533 WEALTEFGQSKGHINP---YLVLECAWR----VSNWTAMKEALVQVEVSCPKEMAWKV 1583
>T2R38_MOUSE (Q7TQA6) Putative taste receptor type 2 member 38 (T2R38) (mT2r31)| Length = 331 Score = 28.1 bits (61), Expect = 5.6 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 5/55 (9%) Frame = -2 Query: 187 VIQCARTHPSSIANW---RFVQHFLVLSKLS--CPKLLLYNVLLRFFSSSFKMYH 38 +++ + T P +A+W RF+Q LV+ LS C L L++ R S+ + H Sbjct: 121 IVRFSHTFPLHVASWVSRRFLQMLLVVLLLSCICTALCLWDFFCRSHSTVTSLLH 175
>KS6AB_XENLA (P10666) Ribosomal protein S6 kinase 2 beta (EC 2.7.11.1)| (Ribosomal protein S6 kinase II beta) (S6KII-beta) (P90-RSK) Length = 629 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 245 LTRRLHRQRWFSTSTACMLCYTVCAHASIVYRQ 147 L R+ RQ++FS AC + +TVC ++ Q Sbjct: 495 LLDRILRQKFFSEREACSVLFTVCKTVEYLHSQ 527
>VG1_SPV4 (P11333) Capsid protein (VP1)| Length = 553 Score = 27.3 bits (59), Expect = 9.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 169 THPSSIANWRFVQHFLVLSKLS 104 +HP S+ W F H+ L KLS Sbjct: 481 SHPQSLDYWHFADHYAQLPKLS 502 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,896,812 Number of Sequences: 219361 Number of extensions: 772376 Number of successful extensions: 1709 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1692 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1709 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)