| Clone Name | rbaet64d06 |
|---|---|
| Clone Library Name | barley_pub |
>KAMA_CLOSU (Q9XBQ8) L-lysine 2,3-aminomutase (EC 5.4.3.2) (KAM) (LAM)| Length = 416 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 5/24 (20%) Frame = -2 Query: 141 LRGHSSSLCVP-----GPGGGGES 85 LRGH+S CVP PGGGG++ Sbjct: 315 LRGHTSGYCVPTFVVDAPGGGGKT 338
>INO1_SPIPO (P42803) Inositol-3-phosphate synthase (EC 5.5.1.4)| (Myo-inositol-1-phosphate synthase) (MI-1-P synthase) (IPS) Length = 510 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 164 VVCTPQTNTSRVQDNLVALSDLVGRLVGAVEREE 265 VV NT R D +V L+D + L+ AVER+E Sbjct: 225 VVVLWTANTERYSDLVVGLNDTMENLLAAVERDE 258
>NU4M_DIDMA (P41308) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 474 Score = 28.9 bits (63), Expect = 3.2 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%) Frame = -1 Query: 184 CLWSTNY--V*STTVLSTRALQLVVRTWSWWW 95 CL +TNY + S T++ R LQL++ + WW Sbjct: 328 CLANTNYERIHSRTMILARGLQLILPLMTTWW 359
>NU4M_MACRO (P92668) NADH-ubiquinone oxidoreductase chain 4 (EC 1.6.5.3) (NADH| dehydrogenase subunit 4) Length = 459 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = -1 Query: 184 CLWSTNY--V*STTVLSTRALQLVVRTWSWWW 95 CL +TNY + S T++ R LQL++ WW Sbjct: 328 CLANTNYERIHSRTMILARGLQLILPLMCTWW 359
>RP54_RALEU (P28615) RNA polymerase sigma-54 factor| Length = 493 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +2 Query: 11 EQTCTQTNTRLGFKASYELAIH*QMDSPPPPGPGTHNELEC 133 E+ CT+ L F+ AI + S PPG G N EC Sbjct: 177 EEICTELPEELEFEIEEVHAILTLLQSFDPPGVGARNAAEC 217
>NIFN_HERSE (O87627) Nitrogenase iron-molybdenum cofactor biosynthesis protein| nifN Length = 443 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 332 PVPARVPRDLQQLHGALRGVPLLL 261 P+PAR R QL A+ G PLLL Sbjct: 282 PIPARYRRQRSQLQDAMLGWPLLL 305 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,531,602 Number of Sequences: 219361 Number of extensions: 919421 Number of successful extensions: 3365 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3352 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)