| Clone Name | rbaet63f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MYSP_BOOMI (Q86RN8) Paramyosin | 33 | 0.36 | 2 | YIJ1_SCHPO (Q9UTM5) Hypothetical protein C1420.01c in chromosome I | 30 | 3.1 | 3 | ARR1_ARATH (Q940D0) Two-component response regulator ARR1 | 29 | 5.2 | 4 | THII_BACSU (O34595) Probable thiamine biosynthesis protein thiI | 29 | 6.8 | 5 | NEO1_RAT (P97603) Neogenin precursor (Fragment) | 28 | 8.9 | 6 | NEO1_HUMAN (Q92859) Neogenin precursor | 28 | 8.9 | 7 | NEO1_MOUSE (P97798) Neogenin precursor | 28 | 8.9 |
|---|
>MYSP_BOOMI (Q86RN8) Paramyosin| Length = 873 Score = 33.1 bits (74), Expect = 0.36 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 2/76 (2%) Frame = +1 Query: 205 RRRLNTSNRKVLSHSHILKPQVLNTE--ERVLATDMACHLRSVSLPSRPHTKVEEELHSL 378 R RL+ N + L H LK + N + LAT + R + R +E +H+L Sbjct: 199 RTRLSAENAEYLKEVHELKVSLDNVNHLKSQLATQLEDTRRRLEDEERKRASLESSMHTL 258 Query: 379 EASISSPSITMETISD 426 E I S + +E S+ Sbjct: 259 EVEIESLKVQLEEESE 274
>YIJ1_SCHPO (Q9UTM5) Hypothetical protein C1420.01c in chromosome I| Length = 580 Score = 30.0 bits (66), Expect = 3.1 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 241 SHSHILKPQVLNTEERVLATD-MACHLRSVSLPSRPHTKVEEELHSLEASISSPSI 405 SHS I++PQ + R+L+TD + + S S P +P K H ++ S +I Sbjct: 133 SHSSIVRPQAKRSSSRLLSTDAFSQFISSFSPPEKPSMKDLALFHGNKSPSSKETI 188
>ARR1_ARATH (Q940D0) Two-component response regulator ARR1| Length = 690 Score = 29.3 bits (64), Expect = 5.2 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +1 Query: 325 VSLPSRPHTKVEEELHSLEASISSPSITMETISDG---LRRLGDIYSTIEE 468 +S+P R T +EE++S EA ++PS M T LR +G + + ++ Sbjct: 530 ISVPVRKATSYQEEVNSSEAGFTTPSYDMFTTRQNDWDLRNIGIAFDSHQD 580
>THII_BACSU (O34595) Probable thiamine biosynthesis protein thiI| Length = 358 Score = 28.9 bits (63), Expect = 6.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 81 PNVAPDLTNLVYKTVEMSWHDSLCLPFEWCCII 179 P +A D T ++ K+ E+ +++ PFE CC I Sbjct: 315 PLIAMDKTEIIEKSREIGTYETSIQPFEDCCTI 347
>NEO1_RAT (P97603) Neogenin precursor (Fragment)| Length = 1377 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 219 HIKPKGALSFSYLETSSTQHRGKSLSNRYGLPS 317 H P+GA S SYL +S + G+SL + PS Sbjct: 1240 HQDPEGATSSSYLASSQEEDSGQSLPTAHVRPS 1272
>NEO1_HUMAN (Q92859) Neogenin precursor| Length = 1461 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 219 HIKPKGALSFSYLETSSTQHRGKSLSNRYGLPS 317 H P+GA S SYL +S + G+SL + PS Sbjct: 1324 HQDPEGATSSSYLASSQEEDSGQSLPTAHVRPS 1356
>NEO1_MOUSE (P97798) Neogenin precursor| Length = 1493 Score = 28.5 bits (62), Expect = 8.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 219 HIKPKGALSFSYLETSSTQHRGKSLSNRYGLPS 317 H P+GA S SYL +S + G+SL + PS Sbjct: 1355 HQDPEGATSSSYLASSQEEDSGQSLPTAHVRPS 1387 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,901,484 Number of Sequences: 219361 Number of extensions: 1415020 Number of successful extensions: 3422 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3422 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)