| Clone Name | rbaet63e11 |
|---|---|
| Clone Library Name | barley_pub |
>ASR1_LYCES (Q08655) Abscisic stress ripening protein 1| Length = 115 Score = 40.4 bits (93), Expect = 0.002 Identities = 16/31 (51%), Positives = 22/31 (70%) Frame = -1 Query: 443 QVKKDPENAHRHKIXXXXXXXXAIGSGGYAF 351 + KKDPE+AH+HKI A+G+GG+AF Sbjct: 56 EAKKDPEHAHKHKIEEEIAAAAAVGAGGFAF 86
>ASR2_LYCES (P37219) Abscisic stress ripening protein 2| Length = 114 Score = 39.3 bits (90), Expect = 0.004 Identities = 16/31 (51%), Positives = 22/31 (70%) Frame = -1 Query: 443 QVKKDPENAHRHKIXXXXXXXXAIGSGGYAF 351 + KKDPE+AH+HKI A+G+GG+AF Sbjct: 58 KAKKDPEHAHKHKIEEEIMAVAAVGAGGFAF 88
>POLG_HCVVP (O92532) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3014 Score = 30.0 bits (66), Expect = 2.7 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +3 Query: 75 LHTTCTQGAAATHDTDQRTYVYITSHIYAQIPGSFWTHAR 194 L T+C+ + HD D R Y Y+T + + W AR Sbjct: 2785 LITSCSSNVSVAHDGDGRRYYYLTRDPVTPLARAAWETAR 2824
>ENV_OMVVS (P16899) Env polyprotein (Coat polyprotein) [Contains: Leader| peptide; Exterior membrane glycoprotein; Transmembrane glycoprotein] Length = 990 Score = 30.0 bits (66), Expect = 2.7 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -2 Query: 151 WLVIYTYVRWSVSCVAAAPCVHVVWSILTCCVSTY 47 W Y+ W V C+ C ++ ++T C+ Y Sbjct: 832 WFSWLKYIPWIVVCIVGVICFRLLMCVITMCLQAY 866
>ASR3_LYCES (P37220) Abscisic stress ripening protein 3| Length = 78 Score = 30.0 bits (66), Expect = 2.7 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -1 Query: 443 QVKKDPENAHRHKI 402 + KKDPENAH+HKI Sbjct: 56 KAKKDPENAHKHKI 69
>TMC1_MOUSE (Q8R4P5) Transmembrane cochlear-expressed protein 1 (Beethoven| protein) (Deafness protein) Length = 757 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 133 YVRWSVSCVAAAPCVHVVWSILTCCVSTYVDYCTYCFCMDM 11 +VR +VS V ++ L C +V +C YC+C D+ Sbjct: 521 FVRLTVSDVLTTYVTILIGDFLRAC---FVRFCNYCWCWDL 558
>TMC1_HUMAN (Q8TDI8) Transmembrane cochlear-expressed protein 1| Length = 760 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 133 YVRWSVSCVAAAPCVHVVWSILTCCVSTYVDYCTYCFCMDM 11 +VR +VS V ++ L C +V +C YC+C D+ Sbjct: 524 FVRLTVSDVLTTYVTILIGDFLRAC---FVRFCNYCWCWDL 561 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,864,683 Number of Sequences: 219361 Number of extensions: 757422 Number of successful extensions: 1792 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1790 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)