| Clone Name | rbaet62c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IRA2_YEAST (P19158) Inhibitory regulator protein IRA2 | 28 | 4.2 | 2 | DPOE_YARLI (Q6C4J0) DNA polymerase epsilon, catalytic subunit A ... | 28 | 4.2 | 3 | Y305_METJA (Q57753) Hypothetical protein MJ0305 | 27 | 9.3 | 4 | ATR_MOUSE (Q9JKK8) Serine/threonine-protein kinase ATR (EC 2.7.1... | 27 | 9.3 | 5 | Y1319_METJA (Q58715) Hypothetical sodium-dependent transporter M... | 27 | 9.3 |
|---|
>IRA2_YEAST (P19158) Inhibitory regulator protein IRA2| Length = 3079 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = +3 Query: 213 RPQSESTSATPFSLLNFSCRKMTASTSVTGMKTAMRIPAKRVWTQK 350 RPQ+ES SATP ++ N ST ++ +R P +++ T++ Sbjct: 979 RPQTESISATPMAITN--------STPLSSAAFGIRSPLQKIRTRR 1016
>DPOE_YARLI (Q6C4J0) DNA polymerase epsilon, catalytic subunit A (EC 2.7.7.7)| (DNA polymerase II subunit A) Length = 2183 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -2 Query: 343 VHTLFAGILIAVFIPVTEVLAVIFLHEKFSSEK 245 VH + + + I V P + A++F+H+ SSEK Sbjct: 1478 VHVVSSAVEIFVITPTWDAPALVFVHQSSSSEK 1510
>Y305_METJA (Q57753) Hypothetical protein MJ0305| Length = 395 Score = 27.3 bits (59), Expect = 9.3 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = -2 Query: 349 FCVHTLFAGILIAV---FIPVTEVLAVIFLHEKFSSEKG-VALVLSLWG 215 +C+ TL GIL+AV FIP + + E F E V LVL L G Sbjct: 247 YCIKTLIGGILVAVISYFIPEVMGMGLTLTKELFIMEFSLVFLVLLLIG 295
>ATR_MOUSE (Q9JKK8) Serine/threonine-protein kinase ATR (EC 2.7.11.1) (Ataxia| telangiectasia and Rad3-related protein) Length = 2635 Score = 27.3 bits (59), Expect = 9.3 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 123 CTLICKLVFCFPSRNPDLY 67 C +IC L+F F S+NP ++ Sbjct: 127 CEVICSLLFLFKSKNPAIF 145
>Y1319_METJA (Q58715) Hypothetical sodium-dependent transporter MJ1319| Length = 492 Score = 27.3 bits (59), Expect = 9.3 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = -2 Query: 358 GVIFCVHTLFAGILIAVFIPVTEVLAVIFLHEKFSSEKGVALVLSL 221 G++F + +FAGI AV I V A+I +KFS + AL+ L Sbjct: 321 GIVFFLALVFAGISSAVSIVEASVSAII---DKFSLSRKKALLAVL 363 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,932,814 Number of Sequences: 219361 Number of extensions: 445052 Number of successful extensions: 1321 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1320 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)