| Clone Name | rbaet61f06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YS96_CAEEL (Q09965) Putative G-protein coupled receptor B0244.6 | 30 | 2.3 | 2 | RIMM_FRATT (Q5NIC5) 16S rRNA-processing protein rimM | 28 | 5.2 |
|---|
>YS96_CAEEL (Q09965) Putative G-protein coupled receptor B0244.6| Length = 982 Score = 29.6 bits (65), Expect = 2.3 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -2 Query: 142 LVVTIRQNGLLPLCCTYNVISCVLVFANAICRDLVSPAHLCMVC 11 L+ I N L + C Y ++S VLVF + I L L +C Sbjct: 199 LITLINCNNTLLIICIYQIVSVVLVFGSLITTTLTLTFVLISLC 242
>RIMM_FRATT (Q5NIC5) 16S rRNA-processing protein rimM| Length = 169 Score = 28.5 bits (62), Expect = 5.2 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -3 Query: 129 SGRTDSYPCA--VRTM*FHAFWYLQMPSVEIWLAL 31 +G + YP A + T+ + WY+Q+P+ +W L Sbjct: 18 NGELNLYPLANSIETLLSYGDWYIQLPATNVWQQL 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,554,047 Number of Sequences: 219361 Number of extensions: 509121 Number of successful extensions: 1011 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1011 length of database: 80,573,946 effective HSP length: 34 effective length of database: 73,115,672 effective search space used: 1754776128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)