| Clone Name | rbaet61a04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VAL1_BCTV (P14991) AL1 protein (40.8 kDa protein) | 28 | 4.8 | 2 | SYN_PORGI (Q7MVE5) Asparaginyl-tRNA synthetase (EC 6.1.1.22) (As... | 28 | 8.2 | 3 | SYN_BACTN (Q8A0Z8) Asparaginyl-tRNA synthetase (EC 6.1.1.22) (As... | 28 | 8.2 |
|---|
>VAL1_BCTV (P14991) AL1 protein (40.8 kDa protein)| Length = 358 Score = 28.5 bits (62), Expect = 4.8 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +1 Query: 49 P*QYISYVHEGSSSAAITTHYRQRGAHNFIAHEMENPIKLTY 174 P +Y S + EG S T R GAHN+I ++ ++ Y Sbjct: 212 PLRYNSIIVEGDSRTGKTMWARSLGAHNYITGHLDFSLRTYY 253
>SYN_PORGI (Q7MVE5) Asparaginyl-tRNA synthetase (EC 6.1.1.22)| (Asparagine--tRNA ligase) (AsnRS) Length = 469 Score = 27.7 bits (60), Expect = 8.2 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -1 Query: 227 WSIHTYIRFISLSINGDI*VSFIGFSISWAMKLC 126 W I + F+ + N D+ FI + + WA+ C Sbjct: 248 WMIEPEVAFLEIEDNMDLAEEFIKYCVQWALDNC 281
>SYN_BACTN (Q8A0Z8) Asparaginyl-tRNA synthetase (EC 6.1.1.22)| (Asparagine--tRNA ligase) (AsnRS) Length = 467 Score = 27.7 bits (60), Expect = 8.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 227 WSIHTYIRFISLSINGDI*VSFIGFSISWAMKLCA 123 W I + F ++ N D+ FI + + WA+ CA Sbjct: 246 WMIEPEVAFNDIADNMDLAEEFIKYCVKWALDNCA 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,040,525 Number of Sequences: 219361 Number of extensions: 581625 Number of successful extensions: 973 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 971 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 973 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)