| Clone Name | rbaet61a02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MNN9_CANAL (P53697) Protein MNN9 | 30 | 1.8 | 2 | PRLR_RABIT (P14787) Prolactin receptor precursor (PRL-R) | 29 | 4.0 |
|---|
>MNN9_CANAL (P53697) Protein MNN9| Length = 368 Score = 30.0 bits (66), Expect = 1.8 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -1 Query: 165 PSGQRAPTCTLTGEKGGTWLVTSPSQRDAASFLNLFPFYNSAE 37 P G + TL G GG +V + RD A F + FPFY+ E Sbjct: 299 PKGDPSTEMTLDGVGGGAVMVKADVHRDGAMFPS-FPFYHLIE 340
>PRLR_RABIT (P14787) Prolactin receptor precursor (PRL-R)| Length = 616 Score = 28.9 bits (63), Expect = 4.0 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -1 Query: 153 RAPTCTLTGEKGGTWLVTSPSQRDAASFLNLFPFYNSAELC 31 + P ++ G K TW + P Q + S P++N A++C Sbjct: 404 KMPYLSVNGSKSSTWPLLQPGQHNTNS-----PYHNIADMC 439 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,213,866 Number of Sequences: 219361 Number of extensions: 500477 Number of successful extensions: 1335 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1335 length of database: 80,573,946 effective HSP length: 34 effective length of database: 73,115,672 effective search space used: 1754776128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)