| Clone Name | rbaet60g09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CYB_ANTSW (Q33865) Cytochrome b | 29 | 3.9 | 2 | BCL6B_HUMAN (Q8N143) B-cell CLL/lymphoma 6 member B protein (Bcl... | 28 | 6.7 | 3 | TS1R3_RAT (Q923K1) Taste receptor type 1 member 3 precursor (Swe... | 28 | 8.7 |
|---|
>CYB_ANTSW (Q33865) Cytochrome b| Length = 381 Score = 28.9 bits (63), Expect = 3.9 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -3 Query: 191 ASLFFSVCLEVHVSWVCYLCSYLLK 117 AS+FF +CL +HV W Y SYL K Sbjct: 87 ASMFF-MCLFLHVGWGIYYGSYLYK 110
>BCL6B_HUMAN (Q8N143) B-cell CLL/lymphoma 6 member B protein (Bcl6-associated| zinc finger protein) (Zinc finger protein 62) Length = 480 Score = 28.1 bits (61), Expect = 6.7 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 9/46 (19%) Frame = -2 Query: 192 CKSFFFSVFRGACIVGVLLVFL---------SAQVMVMVTTRLKLS 82 C FF+S+FRG VGV ++ L + + M T+RL+LS Sbjct: 59 CSGFFYSIFRGRAGVGVDVLSLPGGPEARGFAPLLDFMYTSRLRLS 104
>TS1R3_RAT (Q923K1) Taste receptor type 1 member 3 precursor (Sweet taste| receptor T1R3) Length = 858 Score = 27.7 bits (60), Expect = 8.7 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -3 Query: 164 EVHVSWVCYLCSYLLKSW*W 105 E+ +SW +LCSYL W W Sbjct: 668 ELPLSWANWLCSYLRGPWAW 687 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,799,759 Number of Sequences: 219361 Number of extensions: 460169 Number of successful extensions: 1722 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1721 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)