| Clone Name | rbaet60f10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | THII_STAES (Q8CNW7) Probable thiamine biosynthesis protein thiI | 29 | 3.0 | 2 | THII_STAEQ (Q5HNJ0) Probable thiamine biosynthesis protein thiI | 29 | 3.0 | 3 | YDC1_YEAST (Q02896) Alkaline ceramidase YDC1 (EC 3.5.1.-) | 28 | 8.9 |
|---|
>THII_STAES (Q8CNW7) Probable thiamine biosynthesis protein thiI| Length = 407 Score = 29.3 bits (64), Expect = 3.0 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 2 ENNTL*KQERVPDKRIKIKIQMPARHIIQITIYNSGKIP 118 ENN + + PD IKI+++M A +I + I +G +P Sbjct: 135 ENNNITVNVKNPDYEIKIEVRMDAIYIYEKVIAGAGGLP 173
>THII_STAEQ (Q5HNJ0) Probable thiamine biosynthesis protein thiI| Length = 407 Score = 29.3 bits (64), Expect = 3.0 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 2 ENNTL*KQERVPDKRIKIKIQMPARHIIQITIYNSGKIP 118 ENN + + PD IKI+++M A +I + I +G +P Sbjct: 135 ENNNITVNVKNPDYEIKIEVRMDAIYIYEKVIAGAGGLP 173
>YDC1_YEAST (Q02896) Alkaline ceramidase YDC1 (EC 3.5.1.-)| Length = 317 Score = 27.7 bits (60), Expect = 8.9 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -2 Query: 157 FGTMHNGPVPFCLGYLAGVIDCYLDYVPCWHLDLNLNSF 41 F TM G +PF +G++ CW LD++L SF Sbjct: 195 FITMVMGMIPFVIGFI------------CWQLDIHLCSF 221 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,190,961 Number of Sequences: 219361 Number of extensions: 412195 Number of successful extensions: 1049 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1048 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)