| Clone Name | rbaet60f09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | THIL_METJA (Q60337) Probable thiamine-monophosphate kinase (EC 2... | 30 | 2.2 | 2 | SER1_DROME (P17205) Serine proteases 1/2 precursor (EC 3.4.21.-)... | 28 | 6.3 | 3 | YFDI_ECOLI (P76507) Hypothetical protein yfdI | 28 | 6.3 |
|---|
>THIL_METJA (Q60337) Probable thiamine-monophosphate kinase (EC 2.7.4.16)| (Thiamine-phosphate kinase) Length = 319 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 111 VCITRSIVTIQCVYCLFSFLKQLYY*YSSLERICSCY 1 +C+T + + C L+ LK+ Y ER+C Y Sbjct: 153 ICVTNDLGRVYCALTLYYMLKENKISYKEFERLCQKY 189
>SER1_DROME (P17205) Serine proteases 1/2 precursor (EC 3.4.21.-) (Protein| Jonah 99Cii/99Ciii) Length = 265 Score = 28.1 bits (61), Expect = 6.3 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 41 YNCFKKENRQYTHWIVTIDLVMHTHW 118 Y + QYTHW+ + D++ H H+ Sbjct: 90 YGASIRTQPQYTHWVGSGDIIQHHHY 115
>YFDI_ECOLI (P76507) Hypothetical protein yfdI| Length = 443 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -1 Query: 171 QFLHEEYLSLFLVQVYIYQCVCITRSIVTIQCVYCLFSF 55 ++L LSLFL +YIY I S + + LF+F Sbjct: 88 EYLDARVLSLFLKVIYIYSLYAIFTSYIKTERYVTLFTF 126 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,467,082 Number of Sequences: 219361 Number of extensions: 684172 Number of successful extensions: 1561 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1561 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)