| Clone Name | rbaet60f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NOG1_MOUSE (Q99ME9) Nucleolar GTP-binding protein 1 (Chronic ren... | 28 | 5.0 |
|---|
>NOG1_MOUSE (Q99ME9) Nucleolar GTP-binding protein 1 (Chronic renal failure| gene protein) (GTP-binding protein NGB) Length = 633 Score = 28.5 bits (62), Expect = 5.0 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = +2 Query: 59 NHHHMVQIKNPRSLPKQCRRRDVSPPASVVSNQNLTR 169 N H+ VQ + RS+ ++ +R + PP+S +++ +R Sbjct: 535 NAHYAVQARRSRSVTRKRKREESVPPSSTARSRSCSR 571 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,927,190 Number of Sequences: 219361 Number of extensions: 506801 Number of successful extensions: 1248 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1248 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)