| Clone Name | rbaet60f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PLVAP_MOUSE (Q91VC4) Plasmalemma vesicle-associated protein (Pla... | 28 | 4.7 | 2 | 3CL_HUMAN (Q13412) Pre-T/NK cell-associated protein 3Cl | 28 | 7.9 | 3 | REL1_MOUSE (P47932) Prorelaxin 1 precursor [Contains: Relaxin B ... | 28 | 7.9 |
|---|
>PLVAP_MOUSE (Q91VC4) Plasmalemma vesicle-associated protein (Plasmalemma| vesicle protein 1) (PV-1) (MECA-32 antigen) Length = 438 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -2 Query: 113 DQQEGCVYFFSSLILWQTIIYVTDYYGVIYFILY 12 DQQ GC Y+ L+ ++I G++ F++Y Sbjct: 15 DQQRGCWYYLRYFFLFVSLIQFLIILGLVLFMIY 48
>3CL_HUMAN (Q13412) Pre-T/NK cell-associated protein 3Cl| Length = 51 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 267 IASWLGYLSL*WMRSSWHCRSRVS 196 I SWL YLS + +SW+C+ ++S Sbjct: 28 IRSWLTYLSWGLLCTSWYCKVKMS 51
>REL1_MOUSE (P47932) Prorelaxin 1 precursor [Contains: Relaxin B chain; Relaxin| A chain] Length = 185 Score = 27.7 bits (60), Expect = 7.9 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -1 Query: 273 RLIASWLGYLSL*WMRSSWHCRSRVSLGWPD--LALCRRDY 157 R + LG+ W+ S CR+RVS W D + +C R+Y Sbjct: 4 RFLLQLLGF----WLLLSQPCRTRVSEEWMDGFIRMCGREY 40 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,223,164 Number of Sequences: 219361 Number of extensions: 524005 Number of successful extensions: 1021 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1015 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1021 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)