| Clone Name | rbaet60f03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PI3K2_SOYBN (P42348) Phosphatidylinositol 3-kinase, nodule isofo... | 28 | 5.0 | 2 | HIS51_SYNPX (Q7U924) Imidazole glycerol phosphate synthase subun... | 28 | 6.5 | 3 | PI3K1_SOYBN (P42347) Phosphatidylinositol 3-kinase, root isoform... | 28 | 6.5 |
|---|
>PI3K2_SOYBN (P42348) Phosphatidylinositol 3-kinase, nodule isoform (EC| 2.7.1.137) (PI3-kinase) (PtdIns-3-kinase) (PI3K) (SPI3K-1) Length = 812 Score = 28.5 bits (62), Expect = 5.0 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -2 Query: 119 AHNFLLYDLCMYEHRLCSIYAYVNSSTAYTYPTPVS 12 +H +L+ D C +EHR+ + S + +P+P++ Sbjct: 205 SHMYLVVDFCSFEHRV----VFQESGANFLFPSPIA 236
>HIS51_SYNPX (Q7U924) Imidazole glycerol phosphate synthase subunit hisH1 (EC| 2.4.2.-) (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit hisH1) (ImGP synthase subunit hisH1) (IGPS subunit hisH1) Length = 210 Score = 28.1 bits (61), Expect = 6.5 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -2 Query: 155 NFTFVHD-SAFRLAHNFLLYDLCMYEHRLCS 66 +F FVH AF + H+F Y C Y+ ++ S Sbjct: 146 DFYFVHSYGAFNVPHDFTTYSYCNYDAKIIS 176
>PI3K1_SOYBN (P42347) Phosphatidylinositol 3-kinase, root isoform (EC 2.7.1.137)| (PI3-kinase) (PtdIns-3-kinase) (PI3K) (SPI3K-5) Length = 814 Score = 28.1 bits (61), Expect = 6.5 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = -2 Query: 119 AHNFLLYDLCMYEHRLCSIYAYVNSSTAYTYPTPVS 12 +H +L+ D C +EHR+ + S + +P+P++ Sbjct: 207 SHLYLVVDFCSFEHRV----VFQESGANFLFPSPIA 238 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,092,231 Number of Sequences: 219361 Number of extensions: 429557 Number of successful extensions: 674 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)