| Clone Name | rbaet60d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y849_AQUAE (O67016) Hypothetical UPF0004 protein aq_849 | 29 | 4.0 |
|---|
>Y849_AQUAE (O67016) Hypothetical UPF0004 protein aq_849| Length = 432 Score = 28.9 bits (63), Expect = 4.0 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -1 Query: 163 SLSCA*YTTDDIVYLSLSPGIAVEITPNLSTREEFVLMTC 44 SL CA D + L G VE+TPN + ++ TC Sbjct: 7 SLGCAKNLVDSEILLGKLKGAGVELTPNPEEADVIIVNTC 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,960,288 Number of Sequences: 219361 Number of extensions: 325253 Number of successful extensions: 746 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 740 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 80,573,946 effective HSP length: 30 effective length of database: 73,993,116 effective search space used: 1775834784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)