| Clone Name | rbaet60d01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRA2_CAEEL (P34709) Sex-determining transformer protein 2 precur... | 29 | 3.8 | 2 | TEGU_EHV1B (P28955) Large tegument protein | 28 | 8.5 | 3 | SYI_THEFY (Q47QV9) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 28 | 8.5 |
|---|
>TRA2_CAEEL (P34709) Sex-determining transformer protein 2 precursor (Ce-Tra-2)| Length = 1475 Score = 28.9 bits (63), Expect = 3.8 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -2 Query: 212 KRQGCASSYVHALHRLVAFILVSSLDGFGTS*LYRFCLLAGQTLSAVSLF 63 K GC S + + + + + S+ D S L FCL AG+ L A ++F Sbjct: 587 KNWGCTSILIFPIVFVYWYFIDSNFDKICVSVLPSFCLAAGEELFAKNMF 636
>TEGU_EHV1B (P28955) Large tegument protein| Length = 3421 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 91 PAKRQNRYS*DVPKPSNDDTKIKATRRCRAWTYDDAQ 201 PAK Q + + +VPKP+ D K +A + + D A+ Sbjct: 2856 PAKDQTKSAAEVPKPAKDQAKDQAKDQAKDQAKDQAK 2892
>SYI_THEFY (Q47QV9) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1060 Score = 27.7 bits (60), Expect = 8.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 177 PAPSSCFYLSVVVGWFWHVLAVSVLSFG 94 PA C + GWF+ ++AVS L FG Sbjct: 561 PAQYICEAIDQTRGWFYSLMAVSTLVFG 588 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,726,116 Number of Sequences: 219361 Number of extensions: 480388 Number of successful extensions: 1180 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1179 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)