| Clone Name | rbaet59g11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FLNC_HUMAN (Q14315) Filamin-C (Gamma-filamin) (Filamin-2) (Prote... | 29 | 3.7 | 2 | FILA_HUMAN (P20930) Filaggrin | 29 | 3.7 | 3 | EST1A_MOUSE (P61406) Telomerase-binding protein EST1A (Ever shor... | 28 | 8.3 | 4 | HD2B_MAIZE (Q9M4U5) Histone deacetylase 2b (HD2b) (Zm-HD2b) | 28 | 8.3 |
|---|
>FLNC_HUMAN (Q14315) Filamin-C (Gamma-filamin) (Filamin-2) (Protein FLNc)| (Actin-binding-like protein) (ABP-L) (ABP-280-like protein) Length = 2725 Score = 28.9 bits (63), Expect = 3.7 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = -2 Query: 129 MHGPLSSTPSPFV*SSCNSRGTTLASSGLVVQGWLE*K*ECCD 1 + G L TP+PF S +++G GL V+G E K EC D Sbjct: 1072 LKGGLVGTPAPF---SIDTKGAGTGGLGLTVEGPCEAKIECQD 1111
>FILA_HUMAN (P20930) Filaggrin| Length = 4061 Score = 28.9 bits (63), Expect = 3.7 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 79 TRGSDKRRGGGRQGSMHESDRHPTKSQSKRSDQGT 183 T G GGRQGS HE R+ ++ + + Q T Sbjct: 1454 THGQTAPSTGGRQGSRHEQARNSSRHSASQDGQDT 1488
>EST1A_MOUSE (P61406) Telomerase-binding protein EST1A (Ever shorter telomeres| 1A) (Telomerase subunit EST1A) (EST1-like protein A) Length = 1418 Score = 27.7 bits (60), Expect = 8.3 Identities = 12/46 (26%), Positives = 26/46 (56%) Frame = +2 Query: 50 LLARVVPLELQEDQTKGEGVEDKGPCMKATDILPNHRARDRIKGHK 187 +L +V L ++ED+ KGE ++++ + H++ DR++ K Sbjct: 167 ILNQVEQLRIEEDECKGEAIKEEVNNKPDKTEIEKHQSNDRVRTAK 212
>HD2B_MAIZE (Q9M4U5) Histone deacetylase 2b (HD2b) (Zm-HD2b)| Length = 303 Score = 27.7 bits (60), Expect = 8.3 Identities = 14/42 (33%), Positives = 26/42 (61%), Gaps = 5/42 (11%) Frame = +1 Query: 97 RRGGGRQGSMHESDRHPTKSQS-KRSDQGTQKAP----S*PC 207 ++ GG++G+ H + HP K ++ +D+ T+K+P S PC Sbjct: 238 QKTGGKKGATHVATPHPAKGKTPANNDKLTEKSPKSGGSVPC 279 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,806,166 Number of Sequences: 219361 Number of extensions: 542825 Number of successful extensions: 1367 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1366 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)