| Clone Name | rbaet59g06 |
|---|---|
| Clone Library Name | barley_pub |
>CHIT1_HUMAN (Q13231) Chitotriosidase-1 precursor (EC 3.2.1.14) (Chitinase-1)| Length = 466 Score = 30.0 bits (66), Expect = 1.8 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 2/64 (3%) Frame = +3 Query: 3 IVHLIDWINEFSHTTHNGEQEKLTGHNSS-QQCQKSCRFRAHASIDKVLERKAWKG-HSS 176 I +D++N ++ H G EK+TGHNS + Q+ A ++D +++ KG +S Sbjct: 200 IAQNLDFVNLMAYDFH-GSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPAS 258 Query: 177 KLLL 188 KL+L Sbjct: 259 KLIL 262
>OVGP1_PIG (Q28990) Oviduct-specific glycoprotein precursor (Oviductal| glycoprotein) (Oviductin) (Estrogen-dependent oviduct protein) (POSP-E3) Length = 527 Score = 29.6 bits (65), Expect = 2.3 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +3 Query: 12 LIDWINEFSHTTHNGEQEKLTGHNS 86 L+D+IN S+ H G EK+TGHNS Sbjct: 204 LLDFINVLSYDLH-GSWEKVTGHNS 227
>RPTN_MOUSE (P97347) Repetin| Length = 1130 Score = 29.6 bits (65), Expect = 2.3 Identities = 11/43 (25%), Positives = 26/43 (60%) Frame = +3 Query: 36 SHTTHNGEQEKLTGHNSSQQCQKSCRFRAHASIDKVLERKAWK 164 S+ H+G KL+ NS ++ +++ R+H ++ ++++ WK Sbjct: 886 SYVEHSGRSGKLSQQNSREEVRQTQSQRSHDRREQQIQQQTWK 928
>CAPP4_ARATH (Q8GVE8) Phosphoenolpyruvate carboxylase 4 (EC 4.1.1.31) (PEPCase| 4) (PEPC 4) (AtPPC4) Length = 1032 Score = 29.3 bits (64), Expect = 3.0 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +3 Query: 15 IDWINEFSHTTHNGEQEKLTGHNSS 89 IDW E HNG QE + G++ S Sbjct: 673 IDWYREHIQKNHNGHQEVMVGYSDS 697
>GP149_CHICK (Q9DDD1) Probable G-protein coupled receptor 149 (G-protein coupled| receptor R35) Length = 723 Score = 28.1 bits (61), Expect = 6.7 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 159 MLCVLELCQW-MHVP*IGSSFDIVGMSYALSIFLVLRCVLC 40 ++C+L LC W ++P F SY L +F+V C Sbjct: 162 LICILPLCGWGKYIPTTWGCFTDHASSYILFLFIVYSLCFC 202
>OVGP1_SHEEP (Q28542) Oviduct-specific glycoprotein precursor (Oviductal| glycoprotein) (Oviductin) (Estrogen-dependent oviduct protein) (Estrus-associated oviducal glycoprotein) (OEGP) Length = 539 Score = 27.7 bits (60), Expect = 8.7 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +3 Query: 12 LIDWINEFSHTTHNGEQEKLTGHNS 86 L+D+I+ S+ H G EK+TGHNS Sbjct: 204 LLDFISVLSYDLH-GSWEKVTGHNS 227
>OVGP1_BOVIN (Q28042) Oviduct-specific glycoprotein precursor (Oviductal| glycoprotein) (Oviductin) (Estrogen-dependent oviduct protein) (Fragment) Length = 537 Score = 27.7 bits (60), Expect = 8.7 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +3 Query: 12 LIDWINEFSHTTHNGEQEKLTGHNS 86 L+D+I+ S+ H G EK+TGHNS Sbjct: 201 LLDFISVLSYDLH-GSWEKVTGHNS 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,048,450 Number of Sequences: 219361 Number of extensions: 392364 Number of successful extensions: 898 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 898 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)