| Clone Name | rbaet59e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PTPA2_DEBHA (Q6BU97) Serine/threonine-protein phosphatase 2A act... | 28 | 8.3 | 2 | STAP1_HUMAN (Q9ULZ2) Signal-transducing adaptor protein 1 (STAP-... | 28 | 8.3 |
|---|
>PTPA2_DEBHA (Q6BU97) Serine/threonine-protein phosphatase 2A activator 2 (EC| 5.2.1.8) (Peptidyl-prolyl cis-trans isomerase PTPA-2) (PPIase PTPA-2) (Rotamase PTPA-2) (Phosphotyrosyl phosphatase activator 2) Length = 367 Score = 27.7 bits (60), Expect = 8.3 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = -3 Query: 169 GTDGQWKLDDFEEA*LSQGSKQYKTSPPMDPYGLYYFCI---FF*YLCLVVCLHF 14 G+ G W LDD+ GS Q T P M P ++ + F+ + C+HF Sbjct: 189 GSHGVWGLDDYHFLPFLFGSSQLATHPHMKPKLIHNEELVESFYKQYMYLECIHF 243
>STAP1_HUMAN (Q9ULZ2) Signal-transducing adaptor protein 1 (STAP-1) (Stem cell| adaptor protein 1) (BCR downstream signaling protein 1) (Docking protein BRDG1) Length = 295 Score = 27.7 bits (60), Expect = 8.3 Identities = 14/43 (32%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = +1 Query: 25 TQPNTSIKKKYKNS---IGRMDPLAAMFYTVSILDLTMLLQSH 144 T+ +TS++K+ + + + ++P+ A FYTVS + T +LQ + Sbjct: 152 TEQSTSVEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKN 194 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,331,468 Number of Sequences: 219361 Number of extensions: 622513 Number of successful extensions: 1581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1579 length of database: 80,573,946 effective HSP length: 53 effective length of database: 68,947,813 effective search space used: 1654747512 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)