| Clone Name | rbaet59d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NU3M_LOXAF (Q2I3F4) NADH-ubiquinone oxidoreductase chain 3 (EC 1... | 28 | 5.0 | 2 | NU3M_MAMPR (Q38PR5) NADH-ubiquinone oxidoreductase chain 3 (EC 1... | 28 | 6.5 | 3 | NU3M_ELEMA (Q2I3G7) NADH-ubiquinone oxidoreductase chain 3 (EC 1... | 28 | 6.5 |
|---|
>NU3M_LOXAF (Q2I3F4) NADH-ubiquinone oxidoreductase chain 3 (EC 1.6.5.3) (NADH| dehydrogenase subunit 3) Length = 115 Score = 28.5 bits (62), Expect = 5.0 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +3 Query: 93 IQAQLRTLTIISKLMLIILLYVNVTYERIDVPGLE 197 IQA +LT++ MLIILL + + YE + GLE Sbjct: 79 IQANNTSLTLLMSFMLIILLAIGLAYEWLQ-KGLE 112
>NU3M_MAMPR (Q38PR5) NADH-ubiquinone oxidoreductase chain 3 (EC 1.6.5.3) (NADH| dehydrogenase subunit 3) Length = 115 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +3 Query: 93 IQAQLRTLTIISKLMLIILLYVNVTYERIDVPGLE 197 IQA LT++ MLIILL + + YE + GLE Sbjct: 79 IQANNTNLTLLMSFMLIILLAIGLAYEWLQ-KGLE 112
>NU3M_ELEMA (Q2I3G7) NADH-ubiquinone oxidoreductase chain 3 (EC 1.6.5.3) (NADH| dehydrogenase subunit 3) Length = 115 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +3 Query: 93 IQAQLRTLTIISKLMLIILLYVNVTYERIDVPGLE 197 IQA LT++ MLIILL + + YE + GLE Sbjct: 79 IQANNTNLTLLMSFMLIILLAIGLAYEWLQ-KGLE 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,351,820 Number of Sequences: 219361 Number of extensions: 381435 Number of successful extensions: 888 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 888 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)