| Clone Name | rbaet59b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CD63_RABIT (Q28709) CD63 antigen | 28 | 5.1 | 2 | UFOG4_MANES (Q40286) Anthocyanidin 3-O-glucosyltransferase (EC 2... | 28 | 5.1 | 3 | UFO1_MAIZE (P16166) Anthocyanidin 3-O-glucosyltransferase (EC 2.... | 28 | 6.7 | 4 | ZBED3_HUMAN (Q96IU2) Zinc finger BED domain-containing protein 3 | 28 | 8.7 |
|---|
>CD63_RABIT (Q28709) CD63 antigen| Length = 237 Score = 28.5 bits (62), Expect = 5.1 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 1 DNKTIFVSNRLSKAFTSLIQASSTSWMSISTLRMDLPP 114 DN+T + +R+ K FT A+ T W +I + D P Sbjct: 128 DNQTALILDRMQKDFTCCGAANYTDWATIPGMTRDRVP 165
>UFOG4_MANES (Q40286) Anthocyanidin 3-O-glucosyltransferase (EC 2.4.1.115)| (Flavonol 3-O-glucosyltransferase 4) (UDP-glucose flavonoid 3-O-glucosyltransferase 4) (Fragment) Length = 241 Score = 28.5 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -2 Query: 185 GEKGLEMRRRVLELRANAVASARRGGRSMRNVDMLIHEV 69 G++G E RRR E+ A + GG S +++MLI V Sbjct: 195 GKEGEERRRRAREIGEMAKRTIEEGGSSYLDMEMLIQYV 233
>UFO1_MAIZE (P16166) Anthocyanidin 3-O-glucosyltransferase (EC 2.4.1.115)| (Flavonol 3-O-glucosyltransferase) (UDP-glucose flavonoid 3-O-glucosyltransferase) (Bronze-1) (Bz-McC allele) Length = 471 Score = 28.1 bits (61), Expect = 6.7 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -2 Query: 185 GEKGLEMRRRVLELRANAVASARRGGRSMRNVDMLIHEVLLA 60 GE+G MR R EL+A + GG +N D + V A Sbjct: 430 GEEGARMRARAKELQALVAEAFGPGGECRKNFDRFVEIVCRA 471
>ZBED3_HUMAN (Q96IU2) Zinc finger BED domain-containing protein 3| Length = 234 Score = 27.7 bits (60), Expect = 8.7 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 185 GEKGLEMRRRVLELRANAVASARR 114 GE+ LE RRR L+ A A ARR Sbjct: 160 GERALERRRRALQEEERAAAQARR 183 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.123 0.344 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,156,818 Number of Sequences: 219361 Number of extensions: 412938 Number of successful extensions: 1115 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1115 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)