| Clone Name | rbaet59b03 |
|---|---|
| Clone Library Name | barley_pub |
>S26A1_MOUSE (P58735) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) Length = 704 Score = 31.2 bits (69), Expect = 0.80 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 32 GRIHRFYTSKLTGSIVTGFTAPQTDGP 112 G++H + S++ G+I TGF APQ P Sbjct: 314 GQLHTRFDSRVAGNIPTGFVAPQVPDP 340
>S26A1_RAT (P45380) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) (Canalicular sulfate transporter) (Sulfate/carbonate antiporter) Length = 703 Score = 29.6 bits (65), Expect = 2.3 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 32 GRIHRFYTSKLTGSIVTGFTAPQTDGP 112 G++H + S + G+I TGF APQ P Sbjct: 313 GQLHTRFGSSVAGNIPTGFVAPQIPDP 339
>PAFA2_HUMAN (Q99487) Platelet-activating factor acetylhydrolase 2, cytoplasmic| (EC 3.1.1.47) (Serine-dependent phospholipase A2) (HSD-PLA2) Length = 392 Score = 28.5 bits (62), Expect = 5.2 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +2 Query: 32 GRIHRFYT--SKLTGSIVTGFTAPQTDGPIDPGNGMDSFIQSKL 157 G +HR T + +TG+++ F + +T G +DP G + +++ L Sbjct: 311 GSVHRSQTDFAFVTGNLIGKFFSTETRGSLDPYEGQEVMVRAML 354
>S26A1_HUMAN (Q9H2B4) Sulfate anion transporter 1 (SAT-1) (Solute carrier family| 26 member 1) Length = 701 Score = 28.1 bits (61), Expect = 6.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 32 GRIHRFYTSKLTGSIVTGFTAPQTDGP 112 G++H+ + S + G I TGF PQ P Sbjct: 309 GQLHKRFGSSVAGDIPTGFMPPQVPEP 335
>RECK_MOUSE (Q9Z0J1) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (mRECK) Length = 971 Score = 27.7 bits (60), Expect = 8.9 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 103 SLWCCETCDDRPCQFAC 53 SL+CC+ +D CQ AC Sbjct: 213 SLYCCDRAEDHACQNAC 229
>RECK_HUMAN (O95980) Reversion-inducing cysteine-rich protein with Kazal motifs| precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15) Length = 971 Score = 27.7 bits (60), Expect = 8.9 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -3 Query: 103 SLWCCETCDDRPCQFAC 53 SL+CC+ +D CQ AC Sbjct: 213 SLYCCDRAEDHACQNAC 229
>HMP_ERWCT (Q6D245) Flavohemoprotein (Hemoglobin-like protein)| (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17) (NO oxygenase) (NOD) Length = 396 Score = 27.7 bits (60), Expect = 8.9 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +2 Query: 14 T*NYSGGRIHRFYTSKLTGSIVTGFTAPQTDG-PI---DPGNGMDSFIQ 148 T +SG R R +L S++T FT TDG PI PG + +I+ Sbjct: 146 TGGWSGVRPFRIVNKQLQSSVITSFTLEPTDGQPIADFQPGQYLAIYIK 194 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,064,099 Number of Sequences: 219361 Number of extensions: 362089 Number of successful extensions: 1126 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1092 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1126 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)