| Clone Name | rbaet57a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FBN3_HUMAN (Q75N90) Fibrillin-3 precursor | 30 | 1.6 | 2 | UN13C_HUMAN (Q8NB66) Unc-13 homolog C (Munc13-3) (Fragment) | 30 | 2.1 | 3 | PAK1_YEAST (P38990) Serine/threonine-protein kinase PAK1 (EC 2.7... | 30 | 2.1 | 4 | UN13C_RAT (Q62770) Unc-13 homolog C (Munc13-3) | 29 | 3.7 | 5 | EGFL8_HUMAN (Q99944) EGF-like domain-containing protein 8 precur... | 29 | 3.7 | 6 | CRIM1_HUMAN (Q9NZV1) Cysteine-rich motor neuron 1 protein precur... | 28 | 8.2 |
|---|
>FBN3_HUMAN (Q75N90) Fibrillin-3 precursor| Length = 2809 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 105 YSPEPRQRTCM*SHQCSVVV*YCSLLCKSSK 13 Y+P+ TC+ +CS V C+ LCK++K Sbjct: 2394 YTPDATATTCLDMDECSQVPKPCTFLCKNTK 2424
>UN13C_HUMAN (Q8NB66) Unc-13 homolog C (Munc13-3) (Fragment)| Length = 1190 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 89 LGSGEYRARARVAHQTWKTNWNSTVTRTMGREGRPHQKEIH 211 LG + + + TW +N T +G+E RP E+H Sbjct: 1070 LGDKKRKQGTKTKSNTWSPKYNETFQFILGKENRPGAYELH 1110
>PAK1_YEAST (P38990) Serine/threonine-protein kinase PAK1 (EC 2.7.11.1)| Length = 1142 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 106 QSKSKSSTSNLEDKLEFHGNTDDGK 180 Q K+ + TSNL D +EF+GN D K Sbjct: 1022 QKKATTETSNLTDIVEFNGNNDHRK 1046
>UN13C_RAT (Q62770) Unc-13 homolog C (Munc13-3)| Length = 2204 Score = 28.9 bits (63), Expect = 3.7 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 Query: 89 LGSGEYRARARVAHQTWKTNWNSTVTRTMGREGRPHQKEIH 211 LG + + + TW +N T +G E RP E+H Sbjct: 2084 LGDKKRKQGTKTKSNTWSPKYNETFQFILGNENRPGAYELH 2124
>EGFL8_HUMAN (Q99944) EGF-like domain-containing protein 8 precursor (Epidermal| growth factor-like protein 8) (Multiple EGF-like domain protein 8) (Vascular endothelial-statin 2) (VE-statin-2) Length = 293 Score = 28.9 bits (63), Expect = 3.7 Identities = 25/79 (31%), Positives = 34/79 (43%) Frame = +2 Query: 5 ETTLLDLHNNEQYYTTTEH**DYIQVLCLGSGEYRARARVAHQTWKTNWNSTVTRTMGRE 184 +T ++ LH NE Y Y L L +G R T++T + R M RE Sbjct: 41 QTLVVPLHYNESYSQPV-----YKPYLTLCAG------RRICSTYRTMY-----RVMWRE 84 Query: 185 GRPHQKEIHSEHAVCSSGW 241 R +E+ HAVC GW Sbjct: 85 VR---REVQQTHAVCCQGW 100
>CRIM1_HUMAN (Q9NZV1) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| (Cysteine-rich repeat-containing protein S52) Length = 1036 Score = 27.7 bits (60), Expect = 8.2 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 74 CNLISAQLLCSTARCCANP 18 CN+I+ + C+T R C+NP Sbjct: 133 CNIINGKCECNTIRTCSNP 151 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,890,558 Number of Sequences: 219361 Number of extensions: 690326 Number of successful extensions: 1967 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1927 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1966 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)