| Clone Name | rbaet56g12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DHSB_YEAST (P21801) Succinate dehydrogenase [ubiquinone] iron-su... | 29 | 4.0 | 2 | CRCB2_BACLD (Q65LX3) Protein crcB homolog 2 | 28 | 8.8 |
|---|
>DHSB_YEAST (P21801) Succinate dehydrogenase [ubiquinone] iron-sulfur protein,| mitochondrial precursor (EC 1.3.5.1) (IP) Length = 266 Score = 28.9 bits (63), Expect = 4.0 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 124 LPPGAFPRRTTAIL*SAQAALSVICLFECLLCGVCFTT 11 L +FP+ T +L S + + L+EC+LC C T+ Sbjct: 151 LQRSSFPKDGTEVLQSIEDRKKLDGLYECILCACCSTS 188
>CRCB2_BACLD (Q65LX3) Protein crcB homolog 2| Length = 132 Score = 27.7 bits (60), Expect = 8.8 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -1 Query: 112 AFPRRTTAIL*SAQAALSVICLFECLLCGVCF 17 AF + T +L SA A + V+ L L CGVCF Sbjct: 78 AFSKETVLLLQSA-AHIGVLYLMASLACGVCF 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,239,804 Number of Sequences: 219361 Number of extensions: 206050 Number of successful extensions: 581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 80,573,946 effective HSP length: 33 effective length of database: 73,335,033 effective search space used: 1760040792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)