| Clone Name | rbaet56f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DDR1_HUMAN (Q08345) Epithelial discoidin domain-containing recep... | 28 | 8.4 | 2 | DDR1_PANTR (Q7YR43) Epithelial discoidin domain-containing recep... | 28 | 8.4 |
|---|
>DDR1_HUMAN (Q08345) Epithelial discoidin domain-containing receptor 1| precursor (EC 2.7.10.1) (Epithelial discoidin domain receptor 1) (Tyrosine kinase DDR) (Discoidin receptor tyrosine kinase) (Tyrosine-protein kinase CAK) (Cell adhesion kinase) (TRK E) Length = 913 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -1 Query: 215 GLRVGSTAPPSCPSGLVQCL--CMHVSERERPPW 120 G +V + PP+CP GL + + C +RPP+ Sbjct: 865 GRQVYLSRPPACPQGLYELMLRCWSRESEQRPPF 898
>DDR1_PANTR (Q7YR43) Epithelial discoidin domain-containing receptor 1| precursor (EC 2.7.10.1) (Epithelial discoidin domain receptor 1) (Tyrosine kinase DDR) (Discoidin receptor tyrosine kinase) (CD167a antigen) Length = 909 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -1 Query: 215 GLRVGSTAPPSCPSGLVQCL--CMHVSERERPPW 120 G +V + PP+CP GL + + C +RPP+ Sbjct: 861 GRQVYLSRPPACPQGLYELMLRCWSRESEQRPPF 894 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,366,908 Number of Sequences: 219361 Number of extensions: 434197 Number of successful extensions: 937 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 937 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)