| Clone Name | rbaet56e12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LYPA3_MOUSE (Q8VEB4) 1-O-acylceramide synthase precursor (EC 2.3... | 29 | 3.6 | 2 | ZRP4_MAIZE (P47917) O-methyltransferase ZRP4 (EC 2.1.1.-) (OMT) | 29 | 3.6 | 3 | MDR20_ARATH (Q9LSJ5) Putative multidrug resistance protein 20 (P... | 28 | 4.7 |
|---|
>LYPA3_MOUSE (Q8VEB4) 1-O-acylceramide synthase precursor (EC 2.3.1.-) (ACS)| (Lysosomal phospholipase A2) (Lysophospholipase 3) (LCAT-like lysophospholipase) (LLPL) Length = 412 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +2 Query: 74 ILANLRQSIY--FFHQSRPSIHKQSTLHAWVHQGTPW 178 ++A+ ++Y +F Q +P + K +HA+V G PW Sbjct: 194 LVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPW 230
>ZRP4_MAIZE (P47917) O-methyltransferase ZRP4 (EC 2.1.1.-) (OMT)| Length = 364 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 261 FSDYKIVKRLGARGVIEVY 205 +SDY+I+ LG R +IEVY Sbjct: 345 YSDYRIIPVLGVRSIIEVY 363
>MDR20_ARATH (Q9LSJ5) Putative multidrug resistance protein 20 (P-glycoprotein| 18) Length = 1225 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 4/30 (13%) Frame = -2 Query: 161 VPKHAVCFVYV----WMVCFDEKNKWTALG 84 V K+AV VYV W++CF E WT G Sbjct: 65 VAKNAVALVYVACASWVICFIEGYCWTRTG 94 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,038,985 Number of Sequences: 219361 Number of extensions: 707616 Number of successful extensions: 1769 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1769 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)