| Clone Name | rbaet56e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CATA_BACST (P14412) Peroxidase/catalase (EC 1.11.1.6) (Catalase-... | 29 | 3.7 | 2 | UBP30_HUMAN (Q70CQ3) Ubiquitin carboxyl-terminal hydrolase 30 (E... | 28 | 6.3 |
|---|
>CATA_BACST (P14412) Peroxidase/catalase (EC 1.11.1.6) (Catalase-peroxidase)| Length = 735 Score = 28.9 bits (63), Expect = 3.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 167 WWPLSLSLTCMHRH*TRPDGHD 232 WWP L+L+ +H+H + + HD Sbjct: 31 WWPNQLNLSILHQHDRKTNPHD 52
>UBP30_HUMAN (Q70CQ3) Ubiquitin carboxyl-terminal hydrolase 30 (EC 3.1.2.15)| (Ubiquitin thioesterase 30) (Ubiquitin-specific-processing protease 30) (Deubiquitinating enzyme 30) Length = 517 Score = 28.1 bits (61), Expect = 6.3 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -3 Query: 216 LVQCLCMHVSERERGHHGSPFSLISYYSLSPLMLSNYY 103 L QCLC+H+ HG+P + + ++ + Y Sbjct: 317 LPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIY 354 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,856,263 Number of Sequences: 219361 Number of extensions: 494062 Number of successful extensions: 1006 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1006 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)