| Clone Name | rbaet56e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YWV3_CAEEL (Q11077) Hypothetical protein B0403.3 precursor | 29 | 3.9 | 2 | T4BB_BACCO (Q07606) Restriction enzyme BgcI beta subunit (EC 3.1... | 28 | 6.6 | 3 | Y755_GLUOX (O05543) Hypothetical transport protein GOX0755 | 28 | 6.6 |
|---|
>YWV3_CAEEL (Q11077) Hypothetical protein B0403.3 precursor| Length = 270 Score = 28.9 bits (63), Expect = 3.9 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +2 Query: 53 SAIKQYSISKLKN--LGLNKATQPRLYSNFCRNTKISKQERISAIHMPLY 196 S +K Y S L+ LNK Q LYS+FCR + E +M Y Sbjct: 201 SVVKSYYDSYLEREYTELNKDDQDELYSSFCRRVTPGQDENEFTANMTRY 250
>T4BB_BACCO (Q07606) Restriction enzyme BgcI beta subunit (EC 3.1.21.-)| (S.BcgI) Length = 341 Score = 28.1 bits (61), Expect = 6.6 Identities = 15/46 (32%), Positives = 29/46 (63%), Gaps = 3/46 (6%) Frame = +3 Query: 39 IISYTQRLNNTRFRSLKILV*TR--QPSLGFIQTFV-EIRKSRNKN 167 + SY+ +N+TR +SLKIL+ + +P ++ T++ +I + KN Sbjct: 116 MFSYSYTINSTRLKSLKILLPIKGEEPDWDYMNTYISKILSNMEKN 161
>Y755_GLUOX (O05543) Hypothetical transport protein GOX0755| Length = 739 Score = 28.1 bits (61), Expect = 6.6 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +2 Query: 14 FLSCMGEVHYIIHSAIKQYSISKLKNLGLNKATQPRLYSNF 136 F M YI+ + + SIS L LGL K T+ +L S F Sbjct: 170 FAISMSRATYILLGIVLEASISGLFQLGLTKRTRHQLASTF 210 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,104,953 Number of Sequences: 219361 Number of extensions: 401651 Number of successful extensions: 841 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 841 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)