| Clone Name | rbaet56c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EX5B_BORBU (O51578) Exodeoxyribonuclease V beta chain (EC 3.1.11.5) | 30 | 2.0 | 2 | VLF1_NPVAC (Q06687) Very late expression factor 1 | 28 | 7.6 | 3 | YHL1_EBV (P03181) Hypothetical protein BHLF1 | 28 | 7.6 | 4 | NARG1_PONPY (Q5R4J9) NMDA receptor-regulated protein 1 | 27 | 10.0 | 5 | NARG1_HUMAN (Q9BXJ9) NMDA receptor-regulated protein 1 (N-termin... | 27 | 10.0 |
|---|
>EX5B_BORBU (O51578) Exodeoxyribonuclease V beta chain (EC 3.1.11.5)| Length = 1169 Score = 29.6 bits (65), Expect = 2.0 Identities = 22/51 (43%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +3 Query: 12 ARL-VTSEEKNIFYSEQTYTKALCH**YILFYPPRNYITSNFLPVKIIFLL 161 ARL + SEEKNIFY T K + LF N ITS L + IF + Sbjct: 795 ARLKILSEEKNIFYVGATRAK------FALFIIKINSITSKLLEIAKIFTI 839
>VLF1_NPVAC (Q06687) Very late expression factor 1| Length = 379 Score = 27.7 bits (60), Expect = 7.6 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 5/42 (11%) Frame = -2 Query: 307 WTSSPTCATSSRTTSCP-----RMLRSRGVERNRPSSGIDHH 197 ++ +PT S+ TS P R+L GVE RP S + H Sbjct: 263 YSRNPTILQISKNTSTPFKDFRRLLEESGVEMERPRSNMIRH 304
>YHL1_EBV (P03181) Hypothetical protein BHLF1| Length = 660 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -2 Query: 295 PTCATSSRTTSCPRMLRSR-GVERNRPSSG 209 P C S+R CPR R R G +R P G Sbjct: 519 PGCPRSARNPGCPRTWRRRSGAQRGHPPPG 548 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -2 Query: 295 PTCATSSRTTSCPRMLRSR-GVERNRPSSG 209 P C S+R CPR R R G +R P G Sbjct: 394 PGCPRSARNPGCPRTWRRRSGAQRGHPPPG 423 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -2 Query: 295 PTCATSSRTTSCPRMLRSR-GVERNRPSSG 209 P C S+R CPR R R G +R P G Sbjct: 269 PGCPRSARNPGCPRTWRRRSGAQRGHPPPG 298
>NARG1_PONPY (Q5R4J9) NMDA receptor-regulated protein 1| Length = 866 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +2 Query: 2 HLQSKACYFRRKKHILFRTNVHESLMSLIIHPFLSPTKLHYFKLLACKN 148 HL + YFR++K +L +V + HP+L + F C++ Sbjct: 675 HLFAFEIYFRKEKFLLMLQSVKRAFAIDSSHPWLHECMIRLFNTAVCES 723
>NARG1_HUMAN (Q9BXJ9) NMDA receptor-regulated protein 1 (N-terminal| acetyltransferase) (Tubedown-1 protein) (Tbdn100) (Gastric cancer antigen Ga19) Length = 866 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +2 Query: 2 HLQSKACYFRRKKHILFRTNVHESLMSLIIHPFLSPTKLHYFKLLACKN 148 HL + YFR++K +L +V + HP+L + F C++ Sbjct: 675 HLFAFEIYFRKEKFLLMLQSVKRAFAIDSSHPWLHECMIRLFNTAVCES 723 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,727,971 Number of Sequences: 219361 Number of extensions: 685698 Number of successful extensions: 1801 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1801 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)