| Clone Name | rbaet56c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GANA_HUMIN (P83691) Arabinogalactan endo-1,4-beta-galactosidase ... | 31 | 0.99 | 2 | ATXR3_ARATH (O23372) Probable histone-lysine N-methyltransferase... | 29 | 2.9 | 3 | GANA_THIHE (P83692) Arabinogalactan endo-1,4-beta-galactosidase ... | 28 | 8.4 |
|---|
>GANA_HUMIN (P83691) Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)| (Endo-1,4-beta-galactanase) (Galactanase) Length = 332 Score = 30.8 bits (68), Expect = 0.99 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -1 Query: 108 QERPCEWPRECIDLVWKMYNFRQTLE**NRRPDWG 4 Q P WP + +L WK+YN+ TL+ NR D G Sbjct: 92 QTTPAGWPSDINNLAWKLYNY--TLDSMNRFADAG 124
>ATXR3_ARATH (O23372) Probable histone-lysine N-methyltransferase ATXR3 (EC| 2.1.1.43) (Trithorax-related protein 3) (TRX-related protein 3) (Protein SET DOMAIN GROUP 2) Length = 2351 Score = 29.3 bits (64), Expect = 2.9 Identities = 21/56 (37%), Positives = 31/56 (55%) Frame = +2 Query: 26 YYSNVCRKLYIFHTRSMHSRGHSQGLSCVIELLKRRKHDNYQISLKKRQVEHRPAS 193 Y S+ CRKL +RS+HS +SQ + E L R + + SL+K +H+ AS Sbjct: 322 YGSSKCRKLSDDCSRSLHSDHYSQHSA---ERLYRDSYPSKNSSLEKYPRKHQDAS 374
>GANA_THIHE (P83692) Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)| (Endo-1,4-beta-galactanase) (Galactanase) Length = 332 Score = 27.7 bits (60), Expect = 8.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 108 QERPCEWPRECIDLVWKMYNF 46 Q P WP + +L WK+YN+ Sbjct: 92 QTMPAGWPSDIDNLSWKLYNY 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,348,120 Number of Sequences: 219361 Number of extensions: 539027 Number of successful extensions: 1335 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1335 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)