| Clone Name | rbaet56c06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y3513_METJA (Q60275) Hypothetical MCM-type protein MJECL13 | 32 | 0.63 |
|---|
>Y3513_METJA (Q60275) Hypothetical MCM-type protein MJECL13| Length = 602 Score = 31.6 bits (70), Expect = 0.63 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 9 HIYFIPEMAAIKHAWFNQSFTDSVIQCSM*GGK 107 H+Y P+ IK +F++ F D + C GGK Sbjct: 135 HLYICPKCGRIKEVYFSELFWDDKVFCEFCGGK 167 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,091,796 Number of Sequences: 219361 Number of extensions: 391223 Number of successful extensions: 918 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 80,573,946 effective HSP length: 24 effective length of database: 75,309,282 effective search space used: 1807422768 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)