| Clone Name | rbaet56b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AP2B_HUMAN (Q92481) Transcription factor AP-2 beta (AP2-beta) (A... | 29 | 3.9 | 2 | AP2B_CANFA (Q76HI7) Transcription factor AP-2 beta (AP2-beta) (A... | 29 | 3.9 | 3 | GIS4_YEAST (Q04233) Protein GIS4 | 28 | 8.6 |
|---|
>AP2B_HUMAN (Q92481) Transcription factor AP-2 beta (AP2-beta) (Activating| enhancer-binding protein 2 beta) Length = 449 Score = 28.9 bits (63), Expect = 3.9 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +2 Query: 23 CSTYTALALHIMAXXXXXXXXFWKTLTMNRHNKNE-KGNKDSGSEEKIRK 169 C+ TAL ++ F T NRH E G+K EEK RK Sbjct: 400 CAALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK 449
>AP2B_CANFA (Q76HI7) Transcription factor AP-2 beta (AP2-beta) (Activating| enhancer-binding protein 2 beta) Length = 449 Score = 28.9 bits (63), Expect = 3.9 Identities = 17/50 (34%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +2 Query: 23 CSTYTALALHIMAXXXXXXXXFWKTLTMNRHNKNE-KGNKDSGSEEKIRK 169 C+ TAL ++ F T NRH E G+K EEK RK Sbjct: 400 CAALTALQNYLTEALKGMDKMFLNNTTTNRHTSGEGPGSKTGDKEEKHRK 449
>GIS4_YEAST (Q04233) Protein GIS4| Length = 774 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 101 TMNRHNKNEKGNKDSGSEEKIRK 169 T N H N KGN +S S+ +++K Sbjct: 682 TKNSHKPNSKGNNESNSKNELKK 704 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,888,676 Number of Sequences: 219361 Number of extensions: 287020 Number of successful extensions: 726 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)