| Clone Name | rbaet53e10 |
|---|---|
| Clone Library Name | barley_pub |
>ZN672_MOUSE (Q99LH4) Zinc finger protein 672| Length = 468 Score = 31.2 bits (69), Expect = 0.77 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 Query: 19 SIHPTALPLHVARAHHIVLATLQAHTVSILYVC 117 S +ALP H+ARAH + T+ A + S LY C Sbjct: 137 SFRQSALPFHLARAHPPEIITVTAPSPSTLYHC 169
>Y943_DESVH (Q72DI6) Hypothetical UPF0324 membrane protein DVU0943| Length = 579 Score = 31.2 bits (69), Expect = 0.77 Identities = 11/22 (50%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -2 Query: 65 WCARATC-NGSAVGWMDEWIRY 3 WCAR C +G +VGW++ W R+ Sbjct: 452 WCARVECTSGRSVGWIEIWNRF 473
>Y2133_DESVH (Q72A64) Hypothetical UPF0324 membrane protein DVU2133| Length = 579 Score = 30.8 bits (68), Expect = 1.0 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -2 Query: 65 WCARATCN-GSAVGWMDEWIRY 3 WCAR C G +VGW++ W R+ Sbjct: 452 WCARVECREGHSVGWIEIWHRF 473
>ARI1_MOUSE (Q9Z1K5) Protein ariadne-1 homolog (ARI-1) (Ubiquitin-conjugating| enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein 77) Length = 555 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 99 IDPLCMCRATTMYICMCALY 158 +D LC CRAT MY + A Y Sbjct: 460 VDVLCQCRATLMYTYVFAFY 479
>ARI1_HUMAN (Q9Y4X5) Protein ariadne-1 homolog (ARI-1) (Ubiquitin-conjugating| enzyme E2-binding protein 1) (UbcH7-binding protein) (UbcM4-interacting protein) (HHARI) (H7-AP2) (MOP-6) Length = 557 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 99 IDPLCMCRATTMYICMCALY 158 +D LC CRAT MY + A Y Sbjct: 462 VDVLCQCRATLMYTYVFAFY 481
>ZAN_HUMAN (Q9Y493) Zonadhesin precursor| Length = 2812 Score = 27.7 bits (60), Expect = 8.5 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 95 VCACSVASTIWCARATCNGSAVGW 24 +C CSV + I C ++TC + + W Sbjct: 1892 LCTCSVHNNITCFQSTCKPNQICW 1915
>S35B4_DROME (Q9W429) UDP-xylose and UDP-N-acetylglucosamine transporter-like| Length = 352 Score = 27.7 bits (60), Expect = 8.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 114 MCRATTMYICMCALYGLSS*SAGEEVILVV 203 +C T Y+C+ A+Y L++ A V LVV Sbjct: 255 LCNVVTQYVCISAVYVLTTECASLTVTLVV 284
>SEPT3_MOUSE (Q9Z1S5) Neuronal-specific septin-3| Length = 465 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 30 YSASITCSTSTPYRTGYATSTHRIDPLCMCRATTMYICMCAL 155 Y +S S P Y S +C+C MY+CMC + Sbjct: 348 YHSSHHSFQSVPQACWYLCSILSSVCVCVCVCVCMYVCMCVM 389 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,492,978 Number of Sequences: 219361 Number of extensions: 545880 Number of successful extensions: 1429 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1427 length of database: 80,573,946 effective HSP length: 45 effective length of database: 70,702,701 effective search space used: 1696864824 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)