| Clone Name | rbaet53e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SCNNH_XENLA (O13263) Amiloride-sensitive sodium channel gamma-2-... | 31 | 0.82 |
|---|
>SCNNH_XENLA (O13263) Amiloride-sensitive sodium channel gamma-2-subunit| (Epithelial Na(+) channel gamma-2 subunit) (Gamma-2 ENAC) (Nonvoltage-gated sodium channel 1 gamma-2 subunit) (SCNEG2) (Gamma-2 NACH) Length = 663 Score = 31.2 bits (69), Expect = 0.82 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 28 NMPHYYFCSINNFNTCTRWTIGKGISANLEHGNVYYS 138 NM + C NN + CT +T G G++A E ++Y+ Sbjct: 202 NMVGFKLCDANNSSDCTIFTFGSGVNAIQEWYRLHYN 238 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,255,545 Number of Sequences: 219361 Number of extensions: 264611 Number of successful extensions: 457 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 457 length of database: 80,573,946 effective HSP length: 25 effective length of database: 75,089,921 effective search space used: 1802158104 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)