| Clone Name | rbaet53c09 |
|---|---|
| Clone Library Name | barley_pub |
>TMP14_ARATH (Q8LCA1) Thylakoid membrane phosphoprotein 14 kDa, chloroplast| precursor Length = 174 Score = 43.9 bits (102), Expect = 1e-04 Identities = 19/38 (50%), Positives = 26/38 (68%) Frame = -2 Query: 247 LVGLGYTGWFVYRYLLFKESRKELATDIESFKKKIAGT 134 LVG+GYTGWF Y+ L+FK R+ L ++S K I G+ Sbjct: 136 LVGIGYTGWFTYKNLVFKPDREALFEKVKSTYKDILGS 173
>SYV_ANASP (Q8YX97) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1014 Score = 30.8 bits (68), Expect = 0.97 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -2 Query: 247 LVGLGYTGWFVYRYLLFKESRKELATDI--ESFKKKIAGT 134 +VGLGY+ WFV R LL +RK +K ++GT Sbjct: 880 IVGLGYSAWFVTRNLLSTPARKRFLAKFFAPPTEKNLSGT 919
>VGLI_VZVD (P09258) Glycoprotein I precursor (Glycoprotein IV) (GI) (GPIV)| Length = 354 Score = 29.6 bits (65), Expect = 2.2 Identities = 13/49 (26%), Positives = 29/49 (59%) Frame = +3 Query: 87 LDKRAIRNVPENRVYSVPAIFFLKLSMSVANSFLLSLKRR*RYTNHPVY 233 L ++++ + PEN + +P + + + ++ ++S+KRR R HP+Y Sbjct: 261 LPEKSLNDPPENLLIIIPIVASVMILTAMVIVIVISVKRR-RIKKHPIY 308
>NEC1_MUSCO (P63240) Neuroendocrine convertase 1 precursor (EC 3.4.21.93) (NEC| 1) (PC1) (Prohormone convertase 1) (Proprotein convertase 1) (PC3) (Furin homolog) (Propeptide-processing protease) Length = 753 Score = 28.9 bits (63), Expect = 3.7 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 77 HYIIRQKSHPKRSREPSL 130 HY+ + KSHP+RSR +L Sbjct: 67 HYLFKHKSHPRRSRRSAL 84
>NEC1_MOUSE (P63239) Neuroendocrine convertase 1 precursor (EC 3.4.21.93) (NEC| 1) (PC1) (Prohormone convertase 1) (Proprotein convertase 1) (PC3) (Furin homolog) (Propeptide-processing protease) Length = 753 Score = 28.9 bits (63), Expect = 3.7 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 Query: 77 HYIIRQKSHPKRSREPSL 130 HY+ + KSHP+RSR +L Sbjct: 67 HYLFKHKSHPRRSRRSAL 84
>SEC16_SCHPO (O14029) Multidomain vesicle coat protein| Length = 1995 Score = 28.1 bits (61), Expect = 6.3 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 117 ENRVYSVPAIFFLKLSMSVANSFLLSLKRR*RYTNHPVYPS 239 ENRVY+ ++ L LS V ++ SL + H +YPS Sbjct: 1396 ENRVYAAHLVYILSLSPDVCSNKSNSLFELVGLSKHNLYPS 1436
>CWC25_NEUCR (Q7SI59) Pre-mRNA-splicing factor cwc-25| Length = 444 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 237 SGTPGGSCTATSSSRKAGKSWPPTSRASRRRSQEQNK 127 SG+PGG + + S P+SR R S++QN+ Sbjct: 295 SGSPGGRSSRRREYSRERDSGGPSSRRDDRNSRDQNR 331
>ZA15_ENCCU (Q8SUH6) Zinc finger C2H2 protein ECU10_0150| Length = 388 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -2 Query: 223 WFVYRYL--LFKESRKELATDIESFK 152 WF+YRYL F E R++ +I SFK Sbjct: 61 WFIYRYLDDFFCEERRKAIWNIYSFK 86
>POLX_TOBAC (P10978) Retrovirus-related Pol polyprotein from transposon TNT 1-94| [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1328 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +2 Query: 125 SLFCSCDLLLEALDVGGQLFPAFLEEEVAVHEPPG 229 SL S DL +E LDV LEEE+ + +P G Sbjct: 909 SLAASLDLEVEQLDVKTAFLHGDLEEEIYMEQPEG 943
>NEC1_RAT (P28840) Neuroendocrine convertase 1 precursor (EC 3.4.21.93) (NEC| 1) (PC1) (Prohormone convertase 1) (Proprotein convertase 1) Length = 752 Score = 27.7 bits (60), Expect = 8.2 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 77 HYIIRQKSHPKRSREPSL 130 HY+ + K+HP+RSR +L Sbjct: 67 HYLFKHKNHPRRSRRSAL 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,153,751 Number of Sequences: 219361 Number of extensions: 680155 Number of successful extensions: 2431 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2430 length of database: 80,573,946 effective HSP length: 58 effective length of database: 67,851,008 effective search space used: 1628424192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)