ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet53b05 |
|---|---|
| Clone Library Name | barley_pub |
>POR_AVESA (P15904) Protochlorophyllide reductase (EC 1.3.1.33) (PCR)| (NADPH-protochlorophyllide oxidoreductase) (POR) (Fragment) Length = 313 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA 232 EASDPEKARKVWELSEKLVGLA Sbjct: 292 EASDPEKARKVWELSEKLVGLA 313
>PORA_WHEAT (Q41578) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 388 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA 232 EASDPEKARKVWELSEKLVGLA Sbjct: 367 EASDPEKARKVWELSEKLVGLA 388
>PORA_HORVU (P13653) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 388 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA 232 EASDPEKARKVWELSEKLVGLA Sbjct: 367 EASDPEKARKVWELSEKLVGLA 388
>PORB_HORVU (Q42850) Protochlorophyllide reductase B, chloroplast precursor (EC| 1.3.1.33) (PCR B) (NADPH-protochlorophyllide oxidoreductase B) (POR B) Length = 395 Score = 43.9 bits (102), Expect = 1e-04 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA 232 EASD EKARKVWELSEKLVGLA Sbjct: 374 EASDTEKARKVWELSEKLVGLA 395
>PORA_CUCSA (Q41249) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 398 Score = 43.9 bits (102), Expect = 1e-04 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA 232 EASD EKARKVWELSEKLVGLA Sbjct: 377 EASDAEKARKVWELSEKLVGLA 398
>PORB_ARATH (P21218) Protochlorophyllide reductase B, chloroplast precursor (EC| 1.3.1.33) (PCR B) (NADPH-protochlorophyllide oxidoreductase B) (POR B) Length = 401 Score = 42.7 bits (99), Expect = 2e-04 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA 232 EASD EKARKVWE+SEKLVGLA Sbjct: 380 EASDVEKARKVWEISEKLVGLA 401
>POR_PEA (Q01289) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 399 Score = 42.7 bits (99), Expect = 2e-04 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA 232 EASD EKARKVWE+SEKLVGLA Sbjct: 378 EASDAEKARKVWEVSEKLVGLA 399
>POR_DAUCA (Q9SDT1) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 398 Score = 42.4 bits (98), Expect = 3e-04 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA 232 EASD EKARKVWE+SEKLVGLA Sbjct: 377 EASDVEKARKVWEVSEKLVGLA 398
>PORA_ARATH (Q42536) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 405 Score = 41.2 bits (95), Expect = 7e-04 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA 232 EASD EKAR+VWE+SEKLVGLA Sbjct: 384 EASDVEKARRVWEVSEKLVGLA 405
>PORC_ARATH (O48741) Protochlorophyllide reductase C, chloroplast precursor (EC| 1.3.1.33) (PCR C) (NADPH-protochlorophyllide oxidoreductase C) (POR C) Length = 401 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA 232 EASD EKA+K+WE+SEKLVGLA Sbjct: 380 EASDAEKAKKLWEVSEKLVGLA 401
>POR_MARPA (O80333) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 458 Score = 36.6 bits (83), Expect = 0.017 Identities = 15/21 (71%), Positives = 20/21 (95%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGL 235 EAS+PEKA+++WELSE+L GL Sbjct: 437 EASNPEKAKRLWELSERLSGL 457
>POR_PLEBO (O66148) Light-dependent protochlorophyllide reductase (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) (LPOR) Length = 322 Score = 33.9 bits (76), Expect = 0.11 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA 232 + +D KA+++WELSEKLVGLA Sbjct: 301 KVTDDAKAKRMWELSEKLVGLA 322
>POR_SYNY3 (Q59987) Light-dependent protochlorophyllide reductase (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) (LPOR) Length = 322 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/21 (61%), Positives = 19/21 (90%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGL 235 + SD +KA+++W+LSEKLVGL Sbjct: 301 QGSDAQKAQRMWDLSEKLVGL 321
>RPOB_STRPM (Q48VR1) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1188 Score = 32.7 bits (73), Expect = 0.24 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = -2 Query: 277 GPQGLGAQREARRTRMIHRKSHGCMHASRTPADAQLVVFLNL--FGNYHVYALLEAQLRR 104 GP GL R R +H +G M TP + + NL FG+ + Y ++ R+ Sbjct: 494 GPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRK 553 Query: 103 RGLASGR 83 A+GR Sbjct: 554 VDRATGR 560
>RPOB_STRP6 (Q5XE97) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1188 Score = 32.7 bits (73), Expect = 0.24 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = -2 Query: 277 GPQGLGAQREARRTRMIHRKSHGCMHASRTPADAQLVVFLNL--FGNYHVYALLEAQLRR 104 GP GL R R +H +G M TP + + NL FG+ + Y ++ R+ Sbjct: 494 GPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRK 553 Query: 103 RGLASGR 83 A+GR Sbjct: 554 VDRATGR 560
>RPOB_STRP3 (Q8K8W3) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1188 Score = 32.7 bits (73), Expect = 0.24 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = -2 Query: 277 GPQGLGAQREARRTRMIHRKSHGCMHASRTPADAQLVVFLNL--FGNYHVYALLEAQLRR 104 GP GL R R +H +G M TP + + NL FG+ + Y ++ R+ Sbjct: 494 GPGGLTRDRAGYEVRDVHYTHYGRMCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRK 553 Query: 103 RGLASGR 83 A+GR Sbjct: 554 VDRATGR 560
>RPOB_XYLFT (Q87A32) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1388 Score = 31.6 bits (70), Expect = 0.54 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -2 Query: 277 GPQGLGAQREARRTRMIHRKSHGCMHASRTP--ADAQLVVFLNLFGNYHVYALLEAQLRR 104 GP GL +R R +H +GC+ TP + L+ L +F + Y LE R+ Sbjct: 566 GPGGLTRERAGFEVRDVHLSHYGCLCTIETPEGPNIGLINSLAVFARTNQYGFLETPYRK 625
>RPOB_XYLFA (Q9PA86) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1388 Score = 31.6 bits (70), Expect = 0.54 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -2 Query: 277 GPQGLGAQREARRTRMIHRKSHGCMHASRTP--ADAQLVVFLNLFGNYHVYALLEAQLRR 104 GP GL +R R +H +GC+ TP + L+ L +F + Y LE R+ Sbjct: 566 GPGGLTRERAGFEVRDVHLSHYGCLCTIETPEGPNIGLINSLAVFARTNQYGFLETPYRK 625
>POR_CHLRE (Q39617) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 397 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA 232 E +D KA K+W++S KLVGL+ Sbjct: 375 EVADDSKASKLWDISAKLVGLS 396
>GANA_HUMIN (P83691) Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)| (Endo-1,4-beta-galactanase) (Galactanase) Length = 332 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -1 Query: 107 QERPCEWPRECIDLVWKMYNFRQTLE**NRRPD*G 3 Q P WP + +L WK+YN+ TL+ NR D G Sbjct: 92 QTTPAGWPSDINNLAWKLYNY--TLDSMNRFADAG 124
>RDH13_MOUSE (Q8CEE7) Retinol dehydrogenase 13 (EC 1.1.1.-)| Length = 334 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGLA*STANP 214 EA D E AR++W S +LVGLA + +P Sbjct: 299 EAEDEEVARRLWTESARLVGLAMAHGSP 326
>ENPP1_HUMAN (P22413) Ectonucleotide pyrophosphatase/phosphodiesterase 1 (E-NPP| 1) (Phosphodiesterase I/nucleotide pyrophosphatase 1) (Plasma-cell membrane glycoprotein PC-1) [Includes: Alkaline phosphodiesterase I (EC 3.1.4.1); Nucleotide pyrophosphatase Length = 925 Score = 28.9 bits (63), Expect = 3.5 Identities = 17/47 (36%), Positives = 19/47 (40%) Frame = -2 Query: 298 GGQRPREGPQGLGAQREARRTRMIHRKSHGCMHASRTPADAQLVVFL 158 GG+ PREGP G G R G HA+ P D Q L Sbjct: 16 GGRAPREGPAGNGRDR-------------GRSHAAEAPGDPQAAASL 49
>DHAK_ECOLI (P76015) PTS-dependent dihydroxyacetone kinase,| dihydroxyacetone-binding subunit dhaK (EC 2.7.-.-) Length = 366 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 Query: 258 LSEKLVGLA*STANPMDACMHLGRR 184 L EKLVG A + +DAC LGR+ Sbjct: 165 LIEKLVGAAAERGDSLDACAELGRK 189
>RDH14_HUMAN (Q9HBH5) Retinol dehydrogenase 14 (EC 1.1.1.-) (Alcohol| dehydrogenase PAN2) Length = 336 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -3 Query: 297 EASDPEKARKVWELSEKLVGL 235 +A D ARK+W++SE +VGL Sbjct: 314 KAMDESVARKLWDISEVMVGL 334
>GANA_THIHE (P83692) Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)| (Endo-1,4-beta-galactanase) (Galactanase) Length = 332 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 107 QERPCEWPRECIDLVWKMYNF 45 Q P WP + +L WK+YN+ Sbjct: 92 QTMPAGWPSDIDNLSWKLYNY 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,342,606 Number of Sequences: 219361 Number of extensions: 691721 Number of successful extensions: 1888 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1888 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
