| Clone Name | rbaet53a05 |
|---|---|
| Clone Library Name | barley_pub |
>CBP1_ORYSA (P37890) Serine carboxypeptidase 1 precursor (EC 3.4.16.5) (Serine| carboxypeptidase I) (Carboxypeptidase C) Length = 510 Score = 37.7 bits (86), Expect = 0.008 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = -3 Query: 287 GHTAPEYMPRECLAMIDRWLSGEPL 213 GHT PEY P+E LA RWL+G L Sbjct: 486 GHTVPEYKPQESLAFYSRWLAGSKL 510
>CBP1_HORVU (P07519) Serine carboxypeptidase 1 precursor (EC 3.4.16.5) (Serine| carboxypeptidase I) (Carboxypeptidase C) (CP-MI) [Contains: Serine carboxypeptidase 1 chain A (Serine carboxypeptidase I chain A); Serine carboxypeptidase 1 chain B (Serine car Length = 499 Score = 36.6 bits (83), Expect = 0.017 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 287 GHTAPEYMPRECLAMIDRWLSGEPL 213 GHT PEY P+E A RWL+G L Sbjct: 475 GHTVPEYKPQEAFAFYSRWLAGSKL 499
>OR8S1_HUMAN (Q8NH09) Olfactory receptor 8S1| Length = 359 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 Query: 246 YDRQMAFRRAALSDQLMSRRLLMHVV 169 YDR A RR L Q+M ++L MH+V Sbjct: 120 YDRHAAIRRPLLYGQIMGKQLYMHLV 145
>CBP23_HORVU (P52711) Serine carboxypeptidase II-3 precursor (EC 3.4.16.6)| (CP-MII.3) [Contains: Serine carboxypeptidase II-3 chain A; Serine carboxypeptidase II-3 chain B] Length = 516 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 287 GHTAPEYMPRECLAMIDRWLSGEPL 213 GH P Y PR L ++ +L+G+ L Sbjct: 483 GHEVPSYQPRRALVLVQNFLAGKAL 507
>CBPY_CANAL (P30574) Carboxypeptidase Y precursor (EC 3.4.16.5)| (Carboxypeptidase YSCY) Length = 542 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 287 GHTAPEYMPRECLAMIDRWLSGE 219 GH P P L M++RW+SG+ Sbjct: 517 GHMVPYDQPENALDMVNRWISGD 539
>CBPY_PICPA (P52710) Carboxypeptidase Y precursor (EC 3.4.16.5)| (Carboxypeptidase YSCY) Length = 523 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 287 GHTAPEYMPRECLAMIDRWLSGE 219 GH AP P M++RW+SG+ Sbjct: 497 GHMAPYDQPENSHEMVNRWISGD 519
>FA40A_BRARE (Q803T2) Protein FAM40A| Length = 813 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +2 Query: 89 CRSKVSIQHTLHDNIFHLIYIFSYLLLTTCINNLRDIS*SLRAARRK 229 C S++ +QH + N+F L+ + ++ L +N D S + +A RK Sbjct: 134 CSSELEVQHWMRYNVFLLLDVGAFTALVELLNMEIDNSAACSSAVRK 180 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,890,780 Number of Sequences: 219361 Number of extensions: 629065 Number of successful extensions: 1202 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1202 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)