| Clone Name | rbaet52h12 |
|---|---|
| Clone Library Name | barley_pub |
>CRIM1_MOUSE (Q9JLL0) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| (Fragment) Length = 1028 Score = 28.9 bits (63), Expect = 3.8 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -3 Query: 149 GVNIFVVRICSLVGDTMSYVPI*ECCCVCFDFLYMCN 39 GV+I C + YVP ECC VC D +Y N Sbjct: 353 GVSICFTAQCGELNCERYYVPEGECCPVCEDPIYPLN 389
>RRN3_SCHPO (Q10110) RNA polymerase I specific transcription initiation factor| rrn3 Length = 599 Score = 28.9 bits (63), Expect = 3.8 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 2/69 (2%) Frame = +2 Query: 14 LERTNLLSSYTCTESR--SKHSNILKSVHKTWYRQRANKSLRQICLLLFIYNVLEERCS* 187 L+ NLLS+ TC SR S +S+++ SV + + R +R C F+ N++ + S Sbjct: 93 LQLQNLLSALTCNVSRLDSSNSSLVMSVLDSVWVSRDESFVR--CYTRFLGNLISAQ-SN 149 Query: 188 YLSVVLARL 214 YL +V+ L Sbjct: 150 YLPLVMTML 158
>CRIM1_BRARE (Q7T3Q2) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| Length = 1027 Score = 28.1 bits (61), Expect = 6.5 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -3 Query: 149 GVNIFVVRICSLVGDTMSYVPI*ECCCVCFDFLY 48 GV++ C ++ YVP ECC VC D +Y Sbjct: 356 GVSVCFTAQCGVLHCERYYVPDGECCPVCEDPIY 389
>CRIM1_HUMAN (Q9NZV1) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| (Cysteine-rich repeat-containing protein S52) Length = 1036 Score = 27.7 bits (60), Expect = 8.4 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -3 Query: 149 GVNIFVVRICSLVGDTMSYVPI*ECCCVCFDFLYMCN 39 GV I C + YVP ECC VC D +Y N Sbjct: 362 GVAICFTAQCGEINCERYYVPEGECCPVCEDPVYPFN 398
>RIR1_AQUAE (O66503) Ribonucleoside-diphosphate reductase alpha subunit (EC| 1.17.4.1) (Ribonucleotide reductase) Length = 801 Score = 27.7 bits (60), Expect = 8.4 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = -3 Query: 188 IRSTFPPIHCK*KGVNIFVVRICSLVGDTMSYV 90 IR+T PI K KG + V+ + L+ DTM+YV Sbjct: 271 IRATGAPIR-KFKGASSGVIPVVKLINDTMTYV 302 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,642,328 Number of Sequences: 219361 Number of extensions: 458681 Number of successful extensions: 1229 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1229 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)