| Clone Name | rbaet52h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CB12_PETHY (P13869) Chlorophyll a-b binding protein, chloroplast... | 39 | 0.005 | 2 | CB12_LYCES (P10708) Chlorophyll a-b binding protein 7, chloropla... | 39 | 0.005 | 3 | TOLB_CHLTR (O84604) Protein tolB precursor | 28 | 6.3 | 4 | KLK9_HUMAN (Q9UKQ9) Kallikrein-9 precursor (EC 3.4.21.-) (Kallik... | 28 | 8.2 | 5 | ENV_GALV (P21415) Env polyprotein precursor [Contains: Coat prot... | 28 | 8.2 |
|---|
>CB12_PETHY (P13869) Chlorophyll a-b binding protein, chloroplast precursor| (LHCI type II CAB) Length = 270 Score = 38.5 bits (88), Expect = 0.005 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 246 AHLADPGHATIFRAFAPK 193 AHLADPGHATIF AF+PK Sbjct: 253 AHLADPGHATIFAAFSPK 270
>CB12_LYCES (P10708) Chlorophyll a-b binding protein 7, chloroplast precursor| (LHCI type II CAB-7) Length = 270 Score = 38.5 bits (88), Expect = 0.005 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -2 Query: 246 AHLADPGHATIFRAFAPK 193 AHLADPGHATIF AF+PK Sbjct: 253 AHLADPGHATIFAAFSPK 270
>TOLB_CHLTR (O84604) Protein tolB precursor| Length = 431 Score = 28.1 bits (61), Expect = 6.3 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +2 Query: 20 IVFLHRLHQSTSTHPTSMHCSTITYHHPREK*SNSTSDLLPRGSTLLGFVANSQRVPYLG 199 +VFL L P+++HC + H S S LLP +LL +S++ YL Sbjct: 5 VVFLRSLLCLLCLLPSTLHCEDLEIH------VRSESSLLPIAVSLLSSPKDSRQASYLA 58 Query: 200 A 202 + Sbjct: 59 S 59
>KLK9_HUMAN (Q9UKQ9) Kallikrein-9 precursor (EC 3.4.21.-) (Kallikrein-like| protein 3) (KLK-L3) Length = 250 Score = 27.7 bits (60), Expect = 8.2 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = +3 Query: 54 VHIQQACIAPQLHTIIHGKNNLIPPAIFFPVVAHSSDLLLTPN 182 +++ Q C++P + +I G + P FPV +++ + N Sbjct: 130 LNLSQTCVSPGMQCLISGWGAVSSPKALFPVTLQCANISILEN 172
>ENV_GALV (P21415) Env polyprotein precursor [Contains: Coat protein GP70;| Spike protein p15E] Length = 667 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -1 Query: 199 PQVRNTLGVSNKSEECATTGKKIAGGIRLFFPWMMVCNCGAMHACWMC 56 P VR T+ N TTG ++ ++ F + N GA +CW+C Sbjct: 312 PTVRKTIVTLNTPPP--TTGDRLFDLVQGAFLTLNATNPGATESCWLC 357 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,858,711 Number of Sequences: 219361 Number of extensions: 685470 Number of successful extensions: 2107 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2084 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2107 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)