ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet52d01 |
|---|---|
| Clone Library Name | barley_pub |
>PORA_CUCSA (Q41249) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 398 Score = 49.3 bits (116), Expect = 2e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGLA 228 LSQEASD EKARKVWELSEKLVGLA Sbjct: 374 LSQEASDAEKARKVWELSEKLVGLA 398
>POR_AVESA (P15904) Protochlorophyllide reductase (EC 1.3.1.33) (PCR)| (NADPH-protochlorophyllide oxidoreductase) (POR) (Fragment) Length = 313 Score = 48.5 bits (114), Expect = 4e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGLA 228 LSQEASD EKARKVWELSEKLVGLA Sbjct: 289 LSQEASDPEKARKVWELSEKLVGLA 313
>PORA_WHEAT (Q41578) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 388 Score = 48.5 bits (114), Expect = 4e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGLA 228 LSQEASD EKARKVWELSEKLVGLA Sbjct: 364 LSQEASDPEKARKVWELSEKLVGLA 388
>PORA_HORVU (P13653) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 388 Score = 48.5 bits (114), Expect = 4e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGLA 228 LSQEASD EKARKVWELSEKLVGLA Sbjct: 364 LSQEASDPEKARKVWELSEKLVGLA 388
>PORB_HORVU (Q42850) Protochlorophyllide reductase B, chloroplast precursor (EC| 1.3.1.33) (PCR B) (NADPH-protochlorophyllide oxidoreductase B) (POR B) Length = 395 Score = 48.1 bits (113), Expect = 6e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGLA 228 LS+EASD EKARKVWELSEKLVGLA Sbjct: 371 LSEEASDTEKARKVWELSEKLVGLA 395
>POR_PEA (Q01289) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 399 Score = 48.1 bits (113), Expect = 6e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGLA 228 LSQEASD EKARKVWE+SEKLVGLA Sbjct: 375 LSQEASDAEKARKVWEVSEKLVGLA 399
>PORB_ARATH (P21218) Protochlorophyllide reductase B, chloroplast precursor (EC| 1.3.1.33) (PCR B) (NADPH-protochlorophyllide oxidoreductase B) (POR B) Length = 401 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGLA 228 LS+EASD EKARKVWE+SEKLVGLA Sbjct: 377 LSEEASDVEKARKVWEISEKLVGLA 401
>PORA_ARATH (Q42536) Protochlorophyllide reductase A, chloroplast precursor (EC| 1.3.1.33) (PCR A) (NADPH-protochlorophyllide oxidoreductase A) (POR A) Length = 405 Score = 46.6 bits (109), Expect = 2e-05 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGLA 228 LSQEASD EKAR+VWE+SEKLVGLA Sbjct: 381 LSQEASDVEKARRVWEVSEKLVGLA 405
>POR_DAUCA (Q9SDT1) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 398 Score = 46.6 bits (109), Expect = 2e-05 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGLA 228 LS+EASD EKARKVWE+SEKLVGLA Sbjct: 374 LSEEASDVEKARKVWEVSEKLVGLA 398
>PORC_ARATH (O48741) Protochlorophyllide reductase C, chloroplast precursor (EC| 1.3.1.33) (PCR C) (NADPH-protochlorophyllide oxidoreductase C) (POR C) Length = 401 Score = 44.3 bits (103), Expect = 8e-05 Identities = 20/25 (80%), Positives = 24/25 (96%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGLA 228 LS+EASD EKA+K+WE+SEKLVGLA Sbjct: 377 LSKEASDAEKAKKLWEVSEKLVGLA 401
>POR_SYNY3 (Q59987) Light-dependent protochlorophyllide reductase (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) (LPOR) Length = 322 Score = 37.7 bits (86), Expect = 0.007 Identities = 15/24 (62%), Positives = 22/24 (91%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGL 231 LS++ SD +KA+++W+LSEKLVGL Sbjct: 298 LSEQGSDAQKAQRMWDLSEKLVGL 321
>POR_PLEBO (O66148) Light-dependent protochlorophyllide reductase (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) (LPOR) Length = 322 Score = 37.7 bits (86), Expect = 0.007 Identities = 16/25 (64%), Positives = 22/25 (88%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGLA 228 LS++ +D KA+++WELSEKLVGLA Sbjct: 298 LSEKVTDDAKAKRMWELSEKLVGLA 322
>POR_MARPA (O80333) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 458 Score = 37.0 bits (84), Expect = 0.013 Identities = 16/24 (66%), Positives = 22/24 (91%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGL 231 LS+EAS+ EKA+++WELSE+L GL Sbjct: 434 LSEEASNPEKAKRLWELSERLSGL 457
>POR_CHLRE (Q39617) Protochlorophyllide reductase, chloroplast precursor (EC| 1.3.1.33) (PCR) (NADPH-protochlorophyllide oxidoreductase) (POR) Length = 397 Score = 33.1 bits (74), Expect = 0.18 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGLA 228 +S+E +D KA K+W++S KLVGL+ Sbjct: 372 VSEEVADDSKASKLWDISAKLVGLS 396
>RDH13_MOUSE (Q8CEE7) Retinol dehydrogenase 13 (EC 1.1.1.-)| Length = 334 Score = 31.2 bits (69), Expect = 0.70 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -2 Query: 299 SQEASDXEKARKVWELSEKLVGLA*STANP 210 S EA D E AR++W S +LVGLA + +P Sbjct: 297 SPEAEDEEVARRLWTESARLVGLAMAHGSP 326
>GANA_HUMIN (P83691) Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)| (Endo-1,4-beta-galactanase) (Galactanase) Length = 332 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -3 Query: 109 QERPCEWPRECIDLVWKMYNFRQTLE**NRRPD*G 5 Q P WP + +L WK+YN+ TL+ NR D G Sbjct: 92 QTTPAGWPSDINNLAWKLYNY--TLDSMNRFADAG 124
>WWOX_MOUSE (Q91WL8) WW domain-containing oxidoreductase (EC 1.1.1.-)| Length = 414 Score = 29.6 bits (65), Expect = 2.0 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -2 Query: 299 SQEASDXEKARKVWELSEKLV 237 S+EA E AR +WELSE+L+ Sbjct: 385 SEEAQSEETARALWELSERLI 405
>CHIT_MANSE (P36362) Endochitinase precursor (EC 3.2.1.14)| Length = 554 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +3 Query: 24 FYYSNVCRKLYIFHTRSMHSRGHSQGLSCVIELLKRRKHDNYQLKKRQV 170 ++ +C++L H S RG+ G + V L +R HD + +K V Sbjct: 198 YHVPELCQELDAIHVMSYDLRGNWAGFADVHSPLYKRPHDQWAYEKLNV 246
>PYX_DROME (Q9W0T5) Transient receptor potential channel pyrexia| Length = 956 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 72 SMHSRGHSQGLSCVIELLKRRKHDNYQLKKRQVEH 176 S+H S+ + C++ LL+R+ N ++KR H Sbjct: 170 SLHCAASSKSVECILLLLRRKASINIGIEKRSALH 204
>DHAK_ECOLI (P76015) PTS-dependent dihydroxyacetone kinase,| dihydroxyacetone-binding subunit dhaK (EC 2.7.-.-) Length = 366 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 254 LSEKLVGLA*STANPMDACMHLGRR 180 L EKLVG A + +DAC LGR+ Sbjct: 165 LIEKLVGAAAERGDSLDACAELGRK 189
>RDH14_HUMAN (Q9HBH5) Retinol dehydrogenase 14 (EC 1.1.1.-) (Alcohol| dehydrogenase PAN2) Length = 336 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -2 Query: 302 LSQEASDXEKARKVWELSEKLVGL 231 L +A D ARK+W++SE +VGL Sbjct: 311 LLPKAMDESVARKLWDISEVMVGL 334
>DUSC_SALTI (Q8Z5B2) tRNA-dihydrouridine synthase C (EC 1.-.-.-)| Length = 312 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = -1 Query: 231 RMIHRKSHGCMHASRTPADAQLVVFLIGNYHVYAFLEAQLRRRGLASGRESA*ISCG 61 ++ HR +HASRTP+ + + L+G + + A+ R A G ++CG Sbjct: 44 KVFHRICPELLHASRTPSGTPVRIQLLGQHPQWL---AENAARATALGSYGVDLNCG 97
>GANA_THIHE (P83692) Arabinogalactan endo-1,4-beta-galactosidase (EC 3.2.1.89)| (Endo-1,4-beta-galactanase) (Galactanase) Length = 332 Score = 27.7 bits (60), Expect = 7.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 109 QERPCEWPRECIDLVWKMYNF 47 Q P WP + +L WK+YN+ Sbjct: 92 QTMPAGWPSDIDNLSWKLYNY 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,449,955 Number of Sequences: 219361 Number of extensions: 612506 Number of successful extensions: 1625 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 1612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1625 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
