| Clone Name | rbaet52c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BETT_ECOLI (P0ABC9) High-affinity choline transport protein | 28 | 4.4 | 2 | BETT_ECO57 (P0ABD0) High-affinity choline transport protein | 28 | 4.4 | 3 | SYK_RICPR (Q9ZDF8) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--t... | 27 | 9.9 |
|---|
>BETT_ECOLI (P0ABC9) High-affinity choline transport protein| Length = 677 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 73 IYTYMHYSTTSCTQYSLARWAASGFDSLHLSLPLCRRTSPTPAWSRR 213 ++T HY T + Y+L A G+ S +LPL R++ P + +R Sbjct: 140 VWTLFHYGLTGWSMYALMGMAL-GYFSYRYNLPLTIRSALYPIFGKR 185
>BETT_ECO57 (P0ABD0) High-affinity choline transport protein| Length = 677 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 73 IYTYMHYSTTSCTQYSLARWAASGFDSLHLSLPLCRRTSPTPAWSRR 213 ++T HY T + Y+L A G+ S +LPL R++ P + +R Sbjct: 140 VWTLFHYGLTGWSMYALMGMAL-GYFSYRYNLPLTIRSALYPIFGKR 185
>SYK_RICPR (Q9ZDF8) Lysyl-tRNA synthetase (EC 6.1.1.6) (Lysine--tRNA ligase)| (LysRS) Length = 528 Score = 27.3 bits (59), Expect = 9.9 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 30 YLAREDPNTSSYTNYLHVYALQYY 101 Y + PNTS+Y ++L +A++YY Sbjct: 403 YEPKATPNTSTYLDHLTEFAIRYY 426 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,354,759 Number of Sequences: 219361 Number of extensions: 582534 Number of successful extensions: 1357 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1357 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)