| Clone Name | rbaet51a01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KRA57_HUMAN (Q6L8G8) Keratin-associated protein 5-7 (Keratin-ass... | 28 | 6.9 | 2 | KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-ass... | 28 | 9.0 | 3 | KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-ass... | 28 | 9.0 |
|---|
>KRA57_HUMAN (Q6L8G8) Keratin-associated protein 5-7 (Keratin-associated protein| 5.7) (Ultrahigh sulfur keratin-associated protein 5.7) (Keratin-associated protein 5-3) (Keratin-associated protein 5.3) Length = 165 Score = 28.1 bits (61), Expect = 6.9 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -3 Query: 147 GCRGACGSANVSCWMVACFSVKVGASSRVRLTIALWCISSSC 22 GC G+CG + SC+ C S G+S C SSC Sbjct: 86 GC-GSCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCCQSSC 126
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 27.7 bits (60), Expect = 9.0 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -3 Query: 147 GCRGACGSANVSCWMVACFSVKVGASSRVRLTIALWCISSSC 22 GC G+CG + SC+ C S G+S C SSC Sbjct: 79 GC-GSCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCSQSSC 119
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 27.7 bits (60), Expect = 9.0 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = -3 Query: 147 GCRGACGSANVSCWMVACFSVKVGASSRVRLTIALWCISSSCHP 16 GC G+CG + SC+ C S G+S C SS C P Sbjct: 120 GC-GSCGCSQCSCYKPCCCSSGCGSSC---------CQSSCCKP 153 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.310 0.117 0.344 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,060,172 Number of Sequences: 219361 Number of extensions: 304512 Number of successful extensions: 466 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 465 length of database: 80,573,946 effective HSP length: 26 effective length of database: 74,870,560 effective search space used: 1796893440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)