| Clone Name | rbaet50d04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FBN3_HUMAN (Q75N90) Fibrillin-3 precursor | 30 | 1.8 | 2 | CRIM1_HUMAN (Q9NZV1) Cysteine-rich motor neuron 1 protein precur... | 28 | 9.0 |
|---|
>FBN3_HUMAN (Q75N90) Fibrillin-3 precursor| Length = 2809 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 113 YSPEPRQRTCM*SHQCSVVV*YCSLLCKSSK 21 Y+P+ TC+ +CS V C+ LCK++K Sbjct: 2394 YTPDATATTCLDMDECSQVPKPCTFLCKNTK 2424
>CRIM1_HUMAN (Q9NZV1) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| (Cysteine-rich repeat-containing protein S52) Length = 1036 Score = 27.7 bits (60), Expect = 9.0 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 82 CNLISAQLLCSTARCCANP 26 CN+I+ + C+T R C+NP Sbjct: 133 CNIINGKCECNTIRTCSNP 151 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,548,723 Number of Sequences: 219361 Number of extensions: 267452 Number of successful extensions: 545 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 537 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 545 length of database: 80,573,946 effective HSP length: 28 effective length of database: 74,431,838 effective search space used: 1786364112 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)