| Clone Name | rbaet50d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IFIH1_HUMAN (Q9BYX4) Interferon-induced helicase C domain-contai... | 28 | 6.0 | 2 | ABF2_BACSU (P94552) Alpha-N-arabinofuranosidase 2 (EC 3.2.1.55) ... | 28 | 7.8 |
|---|
>IFIH1_HUMAN (Q9BYX4) Interferon-induced helicase C domain-containing protein 1| (EC 3.6.1.-) (Interferon-induced with helicase C domain protein 1) (Helicase with 2 CARD domains) (Helicard) (Melanoma differentiation-associated protein 5) (MDA-5) (RNA helic Length = 1025 Score = 28.1 bits (61), Expect = 6.0 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +1 Query: 91 DLSLTCIITCHHNNK---YKSSVRHKLIPK 171 D SL I CHH NK Y + +RH L+ K Sbjct: 436 DFSLIIIDECHHTNKEAVYNNIMRHYLMQK 465
>ABF2_BACSU (P94552) Alpha-N-arabinofuranosidase 2 (EC 3.2.1.55) (Arabinosidase| 2) Length = 495 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 6/69 (8%) Frame = +1 Query: 91 DLSLTCIITCHHNNKYKSSVRHKLIPKCN------FS*KKLKTVTTGADPHFLSP*SYNY 252 D+++T I H NK ++ + + + K + +K+ T DPH + P S+ Sbjct: 411 DINIT-ICNIDHQNKAEAEIELRGLHKAADHSGVILTAEKMNAHNTFDDPHHVKPESFRQ 469 Query: 253 HHLGRGKLK 279 + L + KLK Sbjct: 470 YTLSKNKLK 478 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,107,056 Number of Sequences: 219361 Number of extensions: 746410 Number of successful extensions: 1504 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1504 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)